KEGG   Felis catus (domestic cat): 101082106
Entry
101082106         CDS       T02385                                 
Symbol
MRC2
Name
(RefSeq) C-type mannose receptor 2 isoform X1
  KO
K06560  mannose receptor, C type
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082106 (MRC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101082106 (MRC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082106 (MRC2)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101082106 (MRC2)
   04090 CD molecules [BR:fca04090]
    101082106 (MRC2)
   04091 Lectins [BR:fca04091]
    101082106 (MRC2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    101082106 (MRC2)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101082106 (MRC2)
CD molecules [BR:fca04090]
 Proteins
  101082106 (MRC2)
Lectins [BR:fca04091]
 C-Type lectins
  Group 6: Mannose receptor family
   101082106 (MRC2)
SSDB
Motif
Pfam: Lectin_C fn2 UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 101082106
NCBI-ProteinID: XP_023100486
Ensembl: ENSFCAG00000010936
LinkDB
Position
E1:47125256..47177355
AA seq 1483 aa
MGPRRPGPAPWSRHLLRCVLLFGGLHLGHPGAPGDAAAAALPEPNVFLIFSHGLQGCLEA
QGGQVRVSPACNASLPAQRWKWVSRNRLFNLGAMQCLGTGWPGTNTTASLGMYECDREAL
NLRWHCRTLGDQLSLLLGGRTGNTSKAGSPERGDQTRGGQWRIYGSDEDLCARPYYEVYT
IQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCET
FWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLW
IGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPY
VCKKKPNATAERPSPDVWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDL
LSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDS
LEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGE
DQVSYGEARRLCTHHGSQLVTITNRFEQAFVSSLIYNWDGEYFWTALQDLNSTGSFRWLS
GDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTAFRARYICRQSLGTPVTPELP
GPDPTPSLTGSCPQGWGSDPKLRHCYKVFSSERLQDKKNWVQAQRACQDLGAQLLSLASY
EEEHFVANMLNKIFGESEPEIHEQNWFWIGLNRRDPGAGQSWRWSDGLGFSYHNFDRSRH
DDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGTDVREPDVSPQGRREWLRFQEAEY
KFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNLQKFSRGQEQHWWIGLHTAESD
GRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTASREDWGDQRCLTALPYICKRSNGTG
EPQPPDLPPTALGGCPSGWKQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP
LEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYTNWAPGEPSGPSPAPSGNIPTS
CAVVLHSPSAHFTGRWDDRSCTEETHGFICQKSTDPSLSPSPAASPPAPGTVLSYLNGTF
RLLQKPLRWHDALLLCESRNASLARVPDPYTQAFLTQASRGLRTPLWIGLASEEGSRRYS
WVSEEPLSYVSWQDGEPQQPGGCAYVDVDGAWRTTSCDTKLQGAVCGGNSGPPPPRRISY
HGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSILDEMENVFVWEH
LQSSEGQSRGAWLGMNFNPKGGTLVWHDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSG
LWRPGACTNITMGVVCKLPRAEESSFSPSAALPENPAALVVVLMAVLLLLALLTAALILY
RRRQSAERGTFEGARYSRSASGPGEATEKNILVSDMEMNEQQE
NT seq 4452 nt   +upstreamnt  +downstreamnt
atggggccccgccggccgggccccgcgccctggtctcgtcacctgctgcgctgcgtcctg
ctcttcgggggtctgcacctcggccaccccggcgcccccggggacgccgccgccgccgcc
ctcccggaacccaacgtcttcctcatcttcagccatggactgcagggctgcctggaggcc
cagggtgggcaagtcagagtctccccagcctgcaatgccagccttcccgcccagcgctgg
aagtgggtctcccgaaaccggctcttcaacctgggtgccatgcagtgcctgggcacgggc
tggccgggcaccaacaccacagcctccctgggcatgtacgagtgtgaccgggaggccctg
aacctccgctggcactgtcgcaccctgggtgaccagctgtccctgctcctggggggccgt
actggcaacacatccaaggccggcagccccgagcgcggcgaccagacccgcggtggccag
tggcgcatctatggcagtgatgaggatctgtgcgctcggccctactatgaggtctacacc
atccagggaaactcccatgggaagccgtgcaccatccccttcaagtatgacaaccagtgg
ttccacagctgcaccagcacgggccgtgaggatgggcacctgtggtgtgccaccacccag
gactatggcaaggacgagcgctggggcttctgccctatcaagagtaacgactgtgagacc
ttctgggacaaggaccagctgactgacagctgctaccagttcaacttccagtccacgctg
tcgtggagggaggcctgggccagctgcgagcagcagggggcggacctgctgagtatcacg
gagatccacgagcagacctacatcaacgggctcctcactggctacagctccacgctgtgg
attggccttaatgacctggacaccagtggaggctggcagtggtcggacaactcgcccctg
aagtacctcaactgggagagtgatcagccggacaacccgagtgaggagaactgcggggtg
atccgcacggagtcctcgggcggctggcagaaccgcgactgcagcatcgcgctgccctac
gtgtgcaagaagaagcccaacgccacggccgagcgcccgtcccccgacgtgtgggccaac
gtgaaggtggagtgcgagcccagctggcagcccttccagggccactgctaccgcctgcag
gctgagaagcgcagctggcaggagtccaagaaggcgtgtctgcggggcgggggcgacctg
ctcagcatccacagcatggccgagctggagttcatcaccaagcagatcaagcaagaggtg
gaggagctgtggattggcctcaatgatttgaaactgcagatgaattttgagtggtctgat
gggagcctcgtgagcttcacccactggcacccatttgagcccaacaacttccgggacagc
ctggaagactgtgtcaccatctgggggccggaaggtcgttggaatgatagcccctgtaac
caatccttaccgtccatctgcaagaaggcaggccagctgagccagggggccgccgaggag
gaccacggctgccggaagggttggacatggcacagcccatcctgctattggctgggagag
gaccaagtaagctacggtgaggcccggcgcctatgcacccatcacggctctcagctggtc
accatcaccaacaggtttgagcaggcctttgtcagcagcctcatctacaattgggacggc
gagtacttttggaccgccctgcaggacctcaacagcaccggctccttccgctggctcagc
ggggatgaggtcatgtacacccactggaaccgtgaccagcctgggtacagccgtgggggc
tgtgtggccctggccacgggcagcgccatggggctgtgggaggtgaagaattgtaccgcg
ttccgggcccgctacatctgccggcagagcctgggcacgccggtgacgcctgaattgcct
gggccagaccccacgcccagcctcaccggctcctgtccccagggctgggggtcagacccc
aaactccggcactgctataaggtgttcagctcagagcggctgcaggataagaagaactgg
gtgcaggcccagagggcctgccaggatttgggagcccagctgctgagcctggccagctat
gaggaggagcactttgtggccaacatgctcaacaagatctttggtgaatcagagcccgag
atccacgagcagaactggttctggattggtctgaaccgtcgagatcccggagcgggacag
agctggcgctggagcgacggcttggggttttcttatcacaatttcgaccggagccggcac
gacgacgacgacatccggggctgtgcagtgctcgacctggcctccttgcagtgggtggcc
atgcagtgtgagacgcagctggactggatctgcaagatccctcgaggcacagacgtgcgg
gagcccgacgtcagcccacaaggccggcgggagtggctgcgtttccaggaggccgagtac
aagttcttcgagcaccactccacgtgggcccaggcgcagcgcatctgcacgtggttccag
gccgagctggcctccgtgcacagccaggccgagctggacttcctggggcacaacctgcag
aagttctctcggggccaggagcagcactggtggatcggcctgcacactgcagagagtgac
gggcgtttcaggtggacagatggttccattataaacttcatctcctgggcacccggtaaa
cctcggcccatcggcaaggataagaagtgcgtgtacatgaccgccagccgagaggactgg
ggggaccagaggtgcctgacagccttgccttacatctgcaaacgcagcaacggcactgga
gagccgcagcccccagacctgccgcccacggctctggggggctgcccctctggctggaag
cagttcctcaataagtgtttccgaatccagggccaggaccctcaggaccgggtgaagtgg
tcagaggcacagttctcctgtgaacagcaagaggcccaactggtcaccattgccaacccc
ttagagcaagccttcatcacagccagcctgcccaatgtgacctttgacctttggattggc
ctccatgcctctcagagggacttccagtgggtggagcaggagcctctgctgtataccaac
tgggcacctggggagccctctggccccagccctgctcccagtggcaacataccgaccagc
tgtgcggtggtcctgcacagcccctcagctcacttcactggccgctgggatgatcggagc
tgcacggaggagacgcacggcttcatctgccagaagagcacggacccttccctgagccca
tccccagcagcgtcgccccctgccccgggcactgtgctctcctacctcaacggcaccttc
cggctgctgcagaagcctctgcgctggcatgacgccctcctgctgtgtgagagccgcaac
gccagcctggcccgcgtgcctgacccctatacccaggccttcctcactcaggcctcccga
gggctgcgcaccccgctctggatcgggctggccagtgaggagggctcccggaggtactcc
tgggtctcggaggagccgctgagctatgtgagctggcaggacggggagccccagcagcca
gggggctgcgcctacgtggacgtagatggggcctggcgcaccaccagctgtgacaccaag
ctgcagggtgctgtctgtggtgggaacagtgggccccctcctccccgaagaataagctac
cacggcagctgtccccaagggctggccgactccgcctggattcccttccgggagcactgc
tactccttccacatggagctgctgctgggccacaaggaggcgctgcagcgctgccagaga
gcgggtggggcggtcctgtccattctggatgagatggagaatgtgttcgtctgggagcac
ctgcagagctctgagggccagagtcggggtgcctggctgggcatgaacttcaaccccaaa
ggaggcaccctggtctggcatgacaacacagctgtgaactactccaactgggggcccccc
ggcctgggccccagcatgctgagccacaacagctgctactggatccagagcagcagcggg
ctgtggcgcccgggcgcctgcaccaacatcaccatgggcgtcgtctgcaagctccctcga
gccgaggaaagcagcttctctccatcggcagcgctcccggaaaacccggcggccctggtg
gtggtgctgatggcggtgctgctgctcctggccctgctgactgcggccttgatcctctac
cggcggcgacagagcgcggagcgtgggacctttgagggcgcccgttacagccgcagcgcc
tctggccccggcgaggccactgagaagaacattctggtgtctgacatggaaatgaatgag
cagcaggagtag

KEGG   Felis catus (domestic cat): 101092193
Entry
101092193         CDS       T02385                                 
Symbol
MRC1
Name
(RefSeq) macrophage mannose receptor 1
  KO
K06560  mannose receptor, C type
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101092193 (MRC1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101092193 (MRC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092193 (MRC1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101092193 (MRC1)
   04090 CD molecules [BR:fca04090]
    101092193 (MRC1)
   04091 Lectins [BR:fca04091]
    101092193 (MRC1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    101092193 (MRC1)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101092193 (MRC1)
CD molecules [BR:fca04090]
 Proteins
  101092193 (MRC1)
Lectins [BR:fca04091]
 C-Type lectins
  Group 6: Mannose receptor family
   101092193 (MRC1)
SSDB
Motif
Pfam: Lectin_C fn2 Ricin_B_lectin UL45 Xlink CDtoxinA
Other DBs
NCBI-GeneID: 101092193
NCBI-ProteinID: XP_011281924
Ensembl: ENSFCAG00000031929
LinkDB
Position
B4:16722063..16821558
AA seq 1455 aa
MRLSLLLVFACLIPVAVQLLDTRQFLIYNEDHKRCVEALSPSAVQTAVCNQDNEAQKFRW
VSDSRIMSVAFKLCLGVPSKTDWVAVTLYACDPKSEFQKWECKNDTLLGIKGEDLFFNYG
NKQEKNVMLYKGSGLWSRWKIYGTTDDLCARGYEDMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTPDYDTDKLFGYCPLKFEGSESLWNKDPLTGISYQINSKSALTW
HQARRSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGGSPFRY
LNWLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPT
NCPSQWWPYAGHCYKIYREEKKIQRDALTACRKEGGDLASIHSIEEFDFIFSQLGYEPDD
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRACER
PLDYICKTKSQTQPSGTVEVESGCRKGWKRHGFYCYLIGHTLSTFAEANQTCVNEKAYLT
TVEDRYEQAFLTSLVGLRPERYFWTGLSDVQNKGTFQWTIEEKVQFTHWNSDMPGRKAGC
VAMRTGVAGGLWDVLRCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEEWGASSKTSLCF
KLFAKGKHEKKTWFESRDFCKALGGDLASINNKEEQQAIWRLIAATGTYHELFWLGLTYG
SPSEGFVWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDSGMSWNDINCEHLNNWICQIQ
KGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCRRNFGDLVSIQS
ESKKKFLWKYVNRNDAQPAYFIGLLISLDKKFIWMDGSKVDYVSWATGEPNFANDDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATVIPTVPAVPGGCKEGWNFYNNKCFKIFG
FVEEERKNWQEARKACIGFGGNLVSIRNDKEQAFLTYHMKDSKFNAWIGLNDVNSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSRDAGKWMDDTCDSRRGYICQT
LPDSSLPGSPTTVPTDGFIKYGESNYSLMKLKLQWQEAENYCKLHTSLIASILDPYSNAF
AFMQIQKVNEPVWIALNSNLTNNEYAWTDKWRMRYTNWAADEPRLKSACVYMDLDGSWKT
AYCNESFYFLCKRSDEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTRNWGQASL
ECLRMGSSLVSIESAAESSFLSYRVEPLQSKTNFWIGLFRNVEGMWMWINNNPVSFVNWN
TGDPSGERNDCVALSAASGFWNNIHCSSYKGYICKRPKIVDAEPTHALITTKADPRKMDP
SKPASNMAGVVVIVVLLIVTGAGLAAYFFYKKRRVHLPQENTFENTLYFNSRLSPGTSDT
KDLVGNIEQNEHAGI
NT seq 4368 nt   +upstreamnt  +downstreamnt
atgaggctgtccctgctcctggttttcgcctgtctcattccggtggctgtgcagctgttg
gacacgaggcaatttttaatatataatgaagatcacaagcgctgcgtggaagcattaagt
cccagcgcggtccaaacagccgtttgtaatcaagacaacgaagcacagaagttccgatgg
gtgtctgactcgcggattatgagtgtggcctttaaattatgtctgggggtaccatcaaag
acggattgggttgctgtcactctgtatgcctgtgacccgaagagcgaatttcagaaatgg
gagtgcaaaaatgacacgcttttggggatcaagggagaagatttattttttaactatggc
aataagcaagaaaagaatgttatgctttacaagggctccggcttatggagcaggtggaaa
atctatggaaccacagatgacttatgcgccaggggttatgaagacatgtacacactgctg
ggcaatgccaatggggcaacctgtgcatttccattcaagtttgaaaacaagtggtatgca
gactgcacgagcgctgggcgatcagatggatggctctggtgtggaaccaccccagattat
gacacagacaagctatttggatattgtccattgaaatttgagggcagtgaaagcttatgg
aacaaagacccgttgactggcatttcctaccagataaactccaaatcggctttaacttgg
catcaggcaaggaggagctgccaacaacaaagcgccgagctcttgagtatcacggaaatc
cacgagcaaacgtacctgacaggattaaccagttccttgacttccggcctctggattgga
cttaacagcctgagtttcaacagtggctggcagtggagtggtgggagtccattccggtat
ttgaactggttaccaggaagtccatcaacagaacctggaaaaagctgtgtgtcattaaat
cctgggaaaaatgctaaatgggaaaatctggaatgtgttcagaagctaggctatatttgc
aaaaaaggcaacacaactttgaattcttttgtgattccctctgaaagtgatgtgcccact
aactgtccaagccagtggtggccatatgcaggccactgctacaagatttacagagaggag
aagaaaatccaaagagatgccttgactgcatgtaggaaggaaggtggtgatctagccagt
atccacagcatcgaggaatttgactttatcttctcccagctgggatatgagccagatgat
gagttatggattggcttaaatgacatcaagatccaaatgtattttgagtggagcgatggc
accccagtaacatttactaaatggctgcggggggaaccaagccatgaaaacaacaggcag
gaagattgcgttgtaatgaaaggcaaggacgggtactgggcggatagggcttgtgagcgg
cctcttgactacatctgtaagacgaaatctcaaacccaaccttcaggaacagtagaagta
gaaagcggctgccggaaaggctggaaaagacacggcttctactgctatttgattggacac
acactttcaacatttgcagaagcaaaccaaacctgcgtaaatgagaaggcttacttaaca
actgttgaagacagatatgaacaagcatttctaactagtttggttggattgaggcctgaa
agatatttttggacaggactttcagatgtacaaaacaaaggcacctttcaatggaccatt
gaggaaaaggttcagttcacccactggaattcagatatgccagggcgaaaagcaggatgt
gtcgccatgagaactggagttgcagggggcttgtgggatgttttgagatgcgaagagaaa
gcaaaatttgtgtgcaaacactgggccgagggagtaactcgcccaccagagcccacaaca
actcccgaacccaaatgtccagaggaatggggcgccagcagcaaaacgagcttgtgtttc
aagctgtttgcaaaaggaaaacacgagaagaaaacatggtttgaatctcgagatttttgt
aaagctctgggtggtgatctagctagtatcaataataaagaggaacagcaagcaatatgg
cgattgatagcggctaccgggacgtaccatgaactgttttggttgggacttacgtatgga
agtccttcagagggctttgtttggagtgacggttctcctgtttcatatgaaaattgggct
tatggagaacctaataattatcaaaatgttgaatactgtggcgagttgaaaggtgactct
ggtatgtcctggaatgatattaactgtgaacatcttaacaactggatttgccagatacaa
aaaggacaaacaccaaaacctgagccaacaccagctcctcaagacaatccgccagtcacc
gaagatgggtgggttatctacaaagactaccagtattactttagcaaagaaaaggagacc
atggacaacgcccgagcattttgcaggaggaacttcggtgatcttgtttctattcagagt
gaaagtaaaaagaagtttctatggaaatatgtaaacaggaatgatgcacaaccagcatat
tttattggcttattgatcagcttggataaaaagtttatttggatggacggaagcaaagtg
gattatgtgtcttgggccacaggtgaaccgaattttgcaaacgacgatgaaaattgtgtg
accatgtattcaaattcagggttttggaatgacattaattgtggttatccaaacgccttc
atctgccagcggcacaacagcagcatcaatgccacggtcattcctaccgtgcctgcagtc
ccaggaggttgtaaggaaggctggaatttttacaataacaagtgtttcaaaatctttgga
tttgttgaagaagaaagaaaaaattggcaagaggcacgaaaagcttgcataggatttggg
ggcaatctggtatcgatccgcaatgacaaagaacaagcatttctcacctatcacatgaag
gactccaagtttaatgcctggattgggctgaatgatgtgaattcagagcacacgttcctg
tggacggatggtcgaggagttcattatacaaattgggggaaaggttaccctggtgggaga
aggagcagtctgtcctacgaagatgctgactgtgttgttattattggtgggaaatcaagg
gatgcaggaaaatggatggatgacacgtgtgacagtaggcggggctacatatgccaaaca
cttcctgactcttccttgcctggttctccaacaacagttccaacagatggctttattaaa
tatggtgaaagtaactattcactcatgaaattaaagttacagtggcaagaggcggaaaat
tattgcaagctccacacttcccttattgctagcattctggacccctatagtaatgcattt
gcatttatgcaaatacaaaaagttaatgaacccgtgtggatcgccctgaacagtaacttg
accaataatgagtacgcttggactgataaatggaggatgaggtacactaactgggctgct
gatgagcccagactgaaatcagcatgtgtttacatggatcttgatggctcctggaagaca
gcatattgcaatgaaagtttttattttctctgcaaaagatcggatgaaatccctgccacc
gaacctccacaactgcctggcaggtgcccagagtctgagcacacagcatggattcccttc
catggtcactgctactatatcgaatcttcatacacaagaaactggggccaggcttctctg
gaatgtctccgaatgggctcttctttggtttccattgaaagtgctgctgagtcaagtttt
ctgtcatatcgagttgagccacttcaaagcaaaaccaatttttggataggattgttcaga
aatgtcgaaggaatgtggatgtggataaacaacaatccagtttcctttgtcaactggaac
acaggagatccttctggtgaacgaaatgattgtgtagctttatctgcagcttctggattt
tggaataatattcactgttcttcctacaaggggtatatttgtaaaagaccaaaaattgtt
gatgctgaacctactcatgcattaattaccacaaaagctgaccccaggaagatggaccct
tccaaaccagcttccaatatggcaggagtcgtggtcattgtggtcctcctgatcgtaaca
ggtgctggcctcgctgcatatttcttttacaagaagagacgtgtgcacttacctcaagag
aacacatttgaaaacactctctattttaacagtaggttgagtccaggaactagtgataca
aaagatctcgtgggcaacatcgaacagaacgaacatgcaggcatctag

KEGG   Felis catus (domestic cat): 101096335
Entry
101096335         CDS       T02385                                 
Symbol
PLA2R1
Name
(RefSeq) secretory phospholipase A2 receptor isoform X1
  KO
K06560  mannose receptor, C type
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101096335 (PLA2R1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101096335 (PLA2R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096335 (PLA2R1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101096335 (PLA2R1)
   04090 CD molecules [BR:fca04090]
    101096335 (PLA2R1)
   04091 Lectins [BR:fca04091]
    101096335 (PLA2R1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    101096335 (PLA2R1)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101096335 (PLA2R1)
CD molecules [BR:fca04090]
 Proteins
  101096335 (PLA2R1)
Lectins [BR:fca04091]
 C-Type lectins
  Group 6: Mannose receptor family
   101096335 (PLA2R1)
SSDB
Motif
Pfam: Lectin_C fn2 UL45 Xlink Chordopox_A33R
Other DBs
NCBI-GeneID: 101096335
NCBI-ProteinID: XP_006935367
LinkDB
Position
C1:complement(152035646..152153839)
AA seq 1463 aa
MLLLRSLPLLLLLGAPRSFTEGAATALTPDPVLEWQDKGIFVIQSESLKKCIQAGKSALT
LENCKPANKHMLWKWVSNHRLFNIGGSGCLGLNLSNPEQLLSIYECDSTHVSLRWRCNRN
MITGPLQYTVQVNHNNVLVASWKYLHKWISYMSGGGSICEYLHKDLYTIKGNAHGTPCMF
PFQYNHQWHHECTREGREDNLLWCATTSRYERDEKWGFCPDPTSAEVGCDAVWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGALLSIADENEENFVRKHLGSEAVEMWIGLNQLDEN
AGWQWSDRTPLNYLNWNPEISFEPFVEYHCGTLNSLMPNAWQSRDCGSTLPYICKKYLNH
SDQEVTEKDAWKYYTTYCEPGWNPHNRNCYKLQKEKKTWKEALHSCQSDNSTLINIASLA
QVEFLITLLGDENASETWIGLSSNKIPVSFEWSNGSSVTFTNWHALEPQILPNRSQLCVS
AEQSEGHWKVKNCEETLFYVCKKAGHVLSDTESGCQKGWERHGRFCYKIDTVLRSFDHAS
SGYYCPPALVTITNRFEQAFITSLISSVVKTKGGYFWIALQDQNGTGEYTWKTAEGQKSE
PVQYTHWNAYQPRYSGGCVVMRGRNPPGRWEVKDCKQFKAMSLCKQPVGNQEKTEQEERW
PFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVN
ELLHSKFNRTEERQFWIGFNKRNPLNAGSWEWSDGTPVVSSFLDNTYFGEDARNCAIYKA
NKTLLPLHCGSKREWICKIPRDVRPKIPPWYQYDAPWLFYQDAEYLFHTYAAEWSSFEFV
CGWLRGDLLTIHSAHEQEFILSKIRALSKYGINWWIGLQEERANDEFRWRDGTPVTYQNW
DKGRDGSMNNQSQRCGFISSLTGLWASEECSVSMPSICKRKKVWLIEKEKDIPKQHGTCP
KGWLYINYKCLLVKIPKDPRDWKNWTSAQDFCVEEGGTLVAIENEVEQAFITMNLFGQTT
NVWIGLQNGNYEKWLNGKSVAYSNWSPFDINIPSHNITEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGHGFVCEKMQDTSGHSVNTSDMYPVPNTLEYGNRTYKIINANMTWYTAIK
TCLMHGAELASITDQYHQSFLTVILNRLGHPHWIGLFTADNGLNFDWSDGTKSSFTFWKD
DESSILGDCVFADTSGRWSSTACESFLQGAICHVPTETKPFGHPELCSETSIPWIKFKSN
CYSFSTVLDSTSFEAAHEFCKKEGSNLLTIKDETENSFLLEELFAFGSSVQMVWLNAHFD
GDNETIKWFDGTPTDQSNWGIRKPETDHVKPHLCIALRIPEGVWQLSPCQEKKGFICKME
ADIHTIKEHSRKGPSHSIVPLAVALTLIVILAISALSFCIYKHNRGIFRRLAGFGNPYYP
TTNFSTVHLEENILISDLEKNDQ
NT seq 4392 nt   +upstreamnt  +downstreamnt
atgctgttgctgcggtcgctgccgctgctgcttctgctgggggcgccacggagcttcacc
gagggcgcggcgactgcacttacccccgacccggtcctcgagtggcaggataaaggaata
ttcgttatccagagtgagagcctcaagaaatgcattcaagcaggcaaatctgcactgacc
ctggagaactgcaaaccagcaaacaagcacatgctgtggaagtgggtttcaaaccaccgc
ctttttaacataggaggcagtggttgcctgggtctgaatttatcgaatccagagcagcta
ctaagcatatatgagtgtgattccactcacgtttccttgagatggcgctgtaacaggaac
atgatcaccggccctctccagtacacggtccaggtgaatcacaacaacgtgcttgtggcc
tcatggaaatatcttcataagtggatttcctacatgtcaggtggtggaagcatttgtgaa
tatctgcacaaagatttgtatacaatcaaagggaatgcccatggaacaccgtgcatgttt
cccttccagtataaccatcagtggcatcatgaatgcacccgggaagggcgggaagacaac
ttactgtggtgtgccacgacaagccgatatgaaagagatgagaagtggggattttgccca
gatcccacatctgcagaagtgggttgtgatgctgtctgggagaaggatctcaattcacac
atttgctaccaattcaacctgctttcctctctttcctggagtgaggcacattcttcatgc
cagatgcaaggaggagctttactaagtattgcagatgagaacgaagaaaacttcgtaagg
aagcacttgggcagtgaagcggtggaaatgtggataggtctgaatcaactggatgaaaat
gctggctggcagtggtctgatagaacgccgctcaactatctgaactggaacccggaaata
agttttgagccatttgttgagtatcattgtggaacattgaattcattgatgccaaatgcc
tggcagagtcgggattgtgggtccaccttgccttatatatgtaaaaagtatctaaaccac
agtgatcaagaagtgactgaaaaagatgcttggaaatattacactacctactgtgagcct
ggctggaatccccataatcgtaactgctataaacttcagaaagaaaaaaagacctggaag
gaagctttgcattcttgccagtctgacaacagcacattaataaacattgcctcattagca
caggtggagtttcttataaccctccttggagatgaaaatgcatcagaaacatggattggt
ttgagcagcaataaaattccagtttcctttgaatggtccaatggctcttcagtcaccttt
actaattggcacgcacttgagccccaaattcttccaaatagaagccaactatgtgtctca
gcagagcaatctgaggggcactggaaagttaaaaattgtgaagaaacacttttttacgtt
tgtaagaaagcaggccatgtcctttctgacactgaatcaggctgtcaaaagggatgggag
agacatgggagattctgttacaaaattgacactgtccttcgaagctttgaccatgcctcc
agtggttattactgtcctcctgcacttgtaaccattacaaacaggtttgaacaggctttt
attaccagtttgatcagtagtgtggtaaaaacgaagggcggttatttttggatagctctt
caagatcaaaatggcacaggagaatacacttggaagacagcagagggtcagaagtctgag
ccggtgcagtacacacactggaatgcatatcagcctcgctacagtggtggctgtgttgtc
atgcgaggaaggaatccacctggtcgctgggaagtgaaggactgcaaacaatttaaggcg
atgtccctgtgtaagcaaccagtgggaaatcaggagaaaacagagcaggaagagagatgg
ccctttcacccctgctacttggactgggaatcagagcctggcttggcgagctgcttcaag
gtatttcatagtgaaaaagtcctgatgaaaagaacatggagagaagcagaagcattttgt
gaagaatttggagctcatcttgcaagctttgcccatattgaggaagagaattttgtgaat
gagcttttgcattcaaaattcaataggacagaagaaaggcagttctggattggatttaat
aaaagaaacccactgaatgctggctcctgggagtggtctgatgggactcctgttgtctct
tcatttttagacaatacttattttggagaagatgcaagaaattgtgctatttataaagca
aataaaacattgctgcccttgcactgtggttccaaacgtgaatggatatgcaagattcca
agagatgtgagacccaagattccaccctggtaccagtacgatgcaccctggctcttttat
caggatgcagagtatctttttcatacctatgctgcagaatggtcctcctttgagtttgtc
tgtggctggctacgtggtgatcttctcacaattcattctgcacatgagcaagaatttatc
ctcagcaaaataagagcgctatcaaagtatggtataaattggtggattggacttcaagaa
gaaagagccaatgatgaatttcgctggagagatggaacgccagtaacataccaaaactgg
gacaagggaagagatggatctatgaataatcagagccagagatgtggcttcatttcatcc
ctaacaggactctgggctagtgaagagtgttcagtttctatgcctagcatctgtaagcga
aagaaggtttggctcatagagaaagagaaagatatcccaaaacaacatggaacatgtccc
aaaggatggctatatattaactataagtgccttttggtgaaaatccccaaagacccaagg
gattggaagaactggacatcagctcaagatttctgtgttgaagaagggggcacactggtc
gccattgaaaatgaggtggagcaagctttcattactatgaatctttttggccagaccact
aatgtgtggatagggttacaaaatggtaattacgaaaaatggctaaatggaaagtctgtg
gcatattctaactggtctccatttgatataaatattccaagtcataacatcactgaagtt
caaaaacacattcctctctgtgccttgctgtcaagtaatcctaattttcatttcactgga
aaatggtattttgaagactgtggaaaagaaggtcatgggtttgtttgtgaaaaaatgcag
gatacctctggacacagtgtaaatacatctgatatgtatccagtccccaataccttagaa
tatggaaacagaacttataagataattaatgcaaatatgacttggtatacagcaataaaa
acctgcctaatgcatggagcagaattggccagcattacagatcagtatcaccagtccttc
ctcactgttatcctcaaccggttaggacatccccactggattggattgttcactgcagat
aatggtcttaattttgactggtcagatggcaccaaatcctccttcactttttggaaagac
gatgagtcatccatcttgggtgactgtgtttttgccgacaccagtggacgctggagtagc
acagcctgcgagtcatttctgcaaggagcaatttgtcatgtacctactgaaacaaaacca
tttggacacccagagttgtgctcagaaacatctattccctggataaaattcaaaagtaat
tgctacagtttttctacagtcctagacagtacgagttttgaggctgctcatgaattttgc
aaaaaggaaggatctaatcttttaacaatcaaggatgagactgaaaattcatttctccta
gaagagctttttgcttttggttcttctgtccagatggtttggttgaatgctcactttgat
ggtgacaatgaaaccataaagtggtttgatggaactcccacagaccagtcgaactggggc
attcggaagccagagacggaccatgtcaaaccccatctgtgtattgccctgaggatcccc
gaaggagtgtggcagttatctccatgtcaagaaaaaaaaggatttatatgcaaaatggaa
gcagatattcacacaataaaggagcactcaagaaaaggaccaagtcacagcattgtacct
cttgcggtagcactgacactgatagtaattctggcaatttctgcactttccttctgtata
tacaagcacaacagaggtatcttcaggagacttgcagggtttgggaatccttactatcct
acaaccaactttagtacagtacatttggaagaaaacattctcatttctgatcttgagaag
aatgaccaataa

DBGET integrated database retrieval system