KEGG   Felis catus (domestic cat): 101082196
Entry
101082196         CDS       T02385                                 
Symbol
PRKCG
Name
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04150  mTOR signaling pathway
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04929  GnRH secretion
fca04935  Growth hormone synthesis, secretion and action
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05231  Choline metabolism in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082196 (PRKCG)
   04012 ErbB signaling pathway
    101082196 (PRKCG)
   04014 Ras signaling pathway
    101082196 (PRKCG)
   04015 Rap1 signaling pathway
    101082196 (PRKCG)
   04310 Wnt signaling pathway
    101082196 (PRKCG)
   04370 VEGF signaling pathway
    101082196 (PRKCG)
   04066 HIF-1 signaling pathway
    101082196 (PRKCG)
   04020 Calcium signaling pathway
    101082196 (PRKCG)
   04070 Phosphatidylinositol signaling system
    101082196 (PRKCG)
   04071 Sphingolipid signaling pathway
    101082196 (PRKCG)
   04150 mTOR signaling pathway
    101082196 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101082196 (PRKCG)
   04540 Gap junction
    101082196 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101082196 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    101082196 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    101082196 (PRKCG)
   04670 Leukocyte transendothelial migration
    101082196 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    101082196 (PRKCG)
   04929 GnRH secretion
    101082196 (PRKCG)
   04921 Oxytocin signaling pathway
    101082196 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    101082196 (PRKCG)
   04918 Thyroid hormone synthesis
    101082196 (PRKCG)
   04919 Thyroid hormone signaling pathway
    101082196 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    101082196 (PRKCG)
   04916 Melanogenesis
    101082196 (PRKCG)
   04925 Aldosterone synthesis and secretion
    101082196 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082196 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    101082196 (PRKCG)
   04971 Gastric acid secretion
    101082196 (PRKCG)
   04972 Pancreatic secretion
    101082196 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101082196 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101082196 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082196 (PRKCG)
   04727 GABAergic synapse
    101082196 (PRKCG)
   04725 Cholinergic synapse
    101082196 (PRKCG)
   04728 Dopaminergic synapse
    101082196 (PRKCG)
   04726 Serotonergic synapse
    101082196 (PRKCG)
   04720 Long-term potentiation
    101082196 (PRKCG)
   04730 Long-term depression
    101082196 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    101082196 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082196 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101082196 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082196 (PRKCG)
   05206 MicroRNAs in cancer
    101082196 (PRKCG)
   05205 Proteoglycans in cancer
    101082196 (PRKCG)
   05207 Chemical carcinogenesis - receptor activation
    101082196 (PRKCG)
   05231 Choline metabolism in cancer
    101082196 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101082196 (PRKCG)
   05214 Glioma
    101082196 (PRKCG)
   05223 Non-small cell lung cancer
    101082196 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101082196 (PRKCG)
   05161 Hepatitis B
    101082196 (PRKCG)
   05171 Coronavirus disease - COVID-19
    101082196 (PRKCG)
   05163 Human cytomegalovirus infection
    101082196 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101082196 (PRKCG)
   05143 African trypanosomiasis
    101082196 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101082196 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    101082196 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    101082196 (PRKCG)
   05032 Morphine addiction
    101082196 (PRKCG)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101082196 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101082196 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082196 (PRKCG)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101082196 (PRKCG)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101082196 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C ABC1 Kinase-like
Other DBs
NCBI-GeneID: 101082196
NCBI-ProteinID: XP_006940956
Ensembl: ENSFCAG00000001566
UniProt: M3VWV6
LinkDB
Position
E2:complement(4224953..4242911)
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPAIRAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPVSPPPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggcattggg
aaacagggcctgcaatgtcaagtttgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctccctt
ctttatgggctggtgcaccagggcatgaaatgctcctgctgcgaaatgaacgtgcaccgc
cgctgtgtgcgcagcgtgccctctctgtgcggggtggaccacacggagcgccgagggcgc
ctgcagctggagatccgagcacccacggcggatgagatccacgtcacagttggcgaggcc
cgtaaccttatcccaatggaccctaatggtctgtctgacccctacgtgaagctgaagctc
atcccagaccctcggaacttgacaaagcaaaagacccggaccgtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccaggagacgtggagcgcaggctt
agcgtggaggtgtgggactgggaccggacttcccgcaacgatttcatgggcgccatgtcc
ttcggggtctcggagctgctcaaggcgccggtggatggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccagtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtacgagcgggtgcggatgggtccctct
tcctctcccatcccctccccatcccctagtcccacggactccaaacgctgtttctttggg
acaagccctggacgtctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agctttgggaaggtgatgctggctgagcgcaggggctctgatgagctctacgccatcaag
atcctgaagaaagacgtgattgtccaggatgatgatgtggactgcaccctcgtggagaag
cgcgtgctggccctggggggccgaggcccgggaggccggccccactttctcacccagctg
cactccaccttccagaccccggaccgtctgtattttgtgatggagtatgtcaccgggggc
gacctgatgtaccacatccagcaattgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaattagacaacgtgatgctggatgctgaaggacacatcaaaatcactgactttggc
atgtgtaaggagaacgtcttccctgggaccaccacccgcaccttctgtgggaccccagac
tacatagcccctgagatcattgcctaccaaccctatggaaagtctgttgattggtggtcc
tttggggttctgttgtatgagatgttggcaggacagccccctttcgatggggaggatgag
gaagagctgtttcaggctatcatggaacaaaccgtcacttaccccaagtcgctttcccgg
gaagctgtggccatctgcaaggggttcctaactaagcacccagcgaaacgcctgggctca
gggccggacggggagcccgccatccgtgctcatggctttttccgctggatggactgggag
cggctggaacgactggagatcgcgcctccgttcagaccccgtccgtgtggacgcagcggc
gagaacttcgacaagttctttacgcgggcggcgccagcgttgacccccccagaccgcctg
gttctagccagcatcgaccaggccgattttcaaggcttcacctacgtgaacccggatttc
gtgcaccccgacgcccgcagccccgtcagcccgccgccggtgccagtcatgtaa

KEGG   Felis catus (domestic cat): 101086433
Entry
101086433         CDS       T02385                                 
Symbol
PRKCA
Name
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04929  GnRH secretion
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05231  Choline metabolism in cancer
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086433 (PRKCA)
   04012 ErbB signaling pathway
    101086433 (PRKCA)
   04014 Ras signaling pathway
    101086433 (PRKCA)
   04015 Rap1 signaling pathway
    101086433 (PRKCA)
   04310 Wnt signaling pathway
    101086433 (PRKCA)
   04370 VEGF signaling pathway
    101086433 (PRKCA)
   04066 HIF-1 signaling pathway
    101086433 (PRKCA)
   04020 Calcium signaling pathway
    101086433 (PRKCA)
   04070 Phosphatidylinositol signaling system
    101086433 (PRKCA)
   04072 Phospholipase D signaling pathway
    101086433 (PRKCA)
   04071 Sphingolipid signaling pathway
    101086433 (PRKCA)
   04151 PI3K-Akt signaling pathway
    101086433 (PRKCA)
   04150 mTOR signaling pathway
    101086433 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101086433 (PRKCA)
   04540 Gap junction
    101086433 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101086433 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    101086433 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    101086433 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    101086433 (PRKCA)
   04670 Leukocyte transendothelial migration
    101086433 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    101086433 (PRKCA)
   04929 GnRH secretion
    101086433 (PRKCA)
   04912 GnRH signaling pathway
    101086433 (PRKCA)
   04921 Oxytocin signaling pathway
    101086433 (PRKCA)
   04926 Relaxin signaling pathway
    101086433 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    101086433 (PRKCA)
   04918 Thyroid hormone synthesis
    101086433 (PRKCA)
   04919 Thyroid hormone signaling pathway
    101086433 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    101086433 (PRKCA)
   04916 Melanogenesis
    101086433 (PRKCA)
   04925 Aldosterone synthesis and secretion
    101086433 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101086433 (PRKCA)
   04270 Vascular smooth muscle contraction
    101086433 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    101086433 (PRKCA)
   04971 Gastric acid secretion
    101086433 (PRKCA)
   04972 Pancreatic secretion
    101086433 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101086433 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101086433 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101086433 (PRKCA)
   04727 GABAergic synapse
    101086433 (PRKCA)
   04725 Cholinergic synapse
    101086433 (PRKCA)
   04728 Dopaminergic synapse
    101086433 (PRKCA)
   04726 Serotonergic synapse
    101086433 (PRKCA)
   04720 Long-term potentiation
    101086433 (PRKCA)
   04730 Long-term depression
    101086433 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    101086433 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101086433 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    101086433 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101086433 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086433 (PRKCA)
   05206 MicroRNAs in cancer
    101086433 (PRKCA)
   05205 Proteoglycans in cancer
    101086433 (PRKCA)
   05207 Chemical carcinogenesis - receptor activation
    101086433 (PRKCA)
   05231 Choline metabolism in cancer
    101086433 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101086433 (PRKCA)
   05214 Glioma
    101086433 (PRKCA)
   05223 Non-small cell lung cancer
    101086433 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101086433 (PRKCA)
   05161 Hepatitis B
    101086433 (PRKCA)
   05171 Coronavirus disease - COVID-19
    101086433 (PRKCA)
   05164 Influenza A
    101086433 (PRKCA)
   05163 Human cytomegalovirus infection
    101086433 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101086433 (PRKCA)
   05143 African trypanosomiasis
    101086433 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101086433 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    101086433 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101086433 (PRKCA)
   05032 Morphine addiction
    101086433 (PRKCA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101086433 (PRKCA)
   05415 Diabetic cardiomyopathy
    101086433 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101086433 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101086433 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086433 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101086433 (PRKCA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101086433 (PRKCA)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101086433 (PRKCA)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101086433 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 ABC1 APH DUF4656
Other DBs
NCBI-GeneID: 101086433
NCBI-ProteinID: XP_023100236
Ensembl: ENSFCAG00000012011
LinkDB
Position
E1:complement(49934742..50339946)
AA seq 680 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKIPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEGCYVRFLKKAKLGPAGNKVITPSEDRRQLSNNLDRVKLTDFNFLMVLGKGSFGK
VMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDR
LYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLD
SEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEML
AGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVR
EHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSD
FEGFSYVNPQFVHPILQSAV
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaagaaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcttgtcctggtgcggataagggaccggacactgacgaccccaggagc
aagcacaagtttaaaatccacacttatggaagccccaccttctgtgatcactgtgggtca
ttgctgtatggacttatccatcaagggatgaaatgtgacacctgtgatatgaacgtgcac
aagcagtgtgtgatcaatgtccccagcctctgtgggatggaccacacagagaagaggggc
cggatctacctgaaggctgaggtcaccgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaattcctatggatccaaatgggctttcagatccttacgtgaagctgaaactc
attcctgatcccaagaacgagagcaagcagaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagtccttcacgttcaaattgaaaccttctgacaaagaccgacggctg
tccgtagaaatctgggactgggatcgaaccacaaggaacgatttcatgggatccctttcc
tttggagtctcggagctgatgaagataccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccagaaggagatgaagaaggaaacgtggag
ctgaggcagaaattcgagggatgttatgtccgcttcttgaagaaagcgaagctcggccct
gctggtaacaaagtcatcaccccttcagaagacaggagacaactttccaacaaccttgac
agagtgaaactcacagacttcaatttcctcatggtgctggggaaggggagttttggaaag
gtgatgctcgctgacaggaaggggacagaagaactgtatgccatcaaaatcctgaagaag
gacgtggtgattcaggatgacgacgtggagtgcaccatggtggagaagcgagtcctggcc
ttgcttgacaagcccccgttcctgacacagctacactcctgcttccagacggtggatcga
ctgtactttgtcatggaatatgtcaacggtggggacctcatgtaccacatccagcaagta
ggaaaatttaaggaaccacaagcagtattttatgcggcagagatctccattggattgttc
tttcttcataaaagaggaatcatttacagggatctgaagttagacaatgtcatgctggac
tcagaagggcatatcaagattgctgacttcgggatgtgcaaagagcacatgatggatgga
gtcacaaccaggaccttctgtgggactccagattacattgctccagagataatcgcttat
cagccgtatgggaaatccgtggactggtgggcctatggcgtcctcttatatgaaatgcta
gctgggcagcctccatttgatggcgaagatgaagacgagctgtttcagtcgataatggag
cataacgtttcttacccaaaatccttgtccaaggaggccgtttccatctgcaaaggcctg
atgaccaaacaccccggcaagcggctgggttgcgggcccgagggggagagggacgtgcgg
gagcacgccttcttccggaggatcgactgggagaaactcgagaacagggagatccagccg
cccttcaagcccaaagtgtgtggcaaaggtgcagaaaactttgacaagttcttcacgcga
gggcagcctgtcttaacaccacctgatcagctggtcattgctaacatagaccagtctgat
ttcgaggggttctcgtatgtcaacccccagtttgtgcaccccatcttacagagcgcagta
tga

KEGG   Felis catus (domestic cat): 101088970
Entry
101088970         CDS       T02385                                 
Symbol
PRKCB
Name
(RefSeq) protein kinase C beta type isoform X3
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04150  mTOR signaling pathway
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04929  GnRH secretion
fca04931  Insulin resistance
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05140  Leishmaniasis
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05231  Choline metabolism in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101088970 (PRKCB)
   04012 ErbB signaling pathway
    101088970 (PRKCB)
   04014 Ras signaling pathway
    101088970 (PRKCB)
   04015 Rap1 signaling pathway
    101088970 (PRKCB)
   04310 Wnt signaling pathway
    101088970 (PRKCB)
   04370 VEGF signaling pathway
    101088970 (PRKCB)
   04064 NF-kappa B signaling pathway
    101088970 (PRKCB)
   04066 HIF-1 signaling pathway
    101088970 (PRKCB)
   04020 Calcium signaling pathway
    101088970 (PRKCB)
   04070 Phosphatidylinositol signaling system
    101088970 (PRKCB)
   04071 Sphingolipid signaling pathway
    101088970 (PRKCB)
   04150 mTOR signaling pathway
    101088970 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101088970 (PRKCB)
   04540 Gap junction
    101088970 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101088970 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    101088970 (PRKCB)
   04662 B cell receptor signaling pathway
    101088970 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    101088970 (PRKCB)
   04670 Leukocyte transendothelial migration
    101088970 (PRKCB)
   04062 Chemokine signaling pathway
    101088970 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    101088970 (PRKCB)
   04929 GnRH secretion
    101088970 (PRKCB)
   04912 GnRH signaling pathway
    101088970 (PRKCB)
   04921 Oxytocin signaling pathway
    101088970 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    101088970 (PRKCB)
   04918 Thyroid hormone synthesis
    101088970 (PRKCB)
   04919 Thyroid hormone signaling pathway
    101088970 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    101088970 (PRKCB)
   04916 Melanogenesis
    101088970 (PRKCB)
   04925 Aldosterone synthesis and secretion
    101088970 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101088970 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    101088970 (PRKCB)
   04971 Gastric acid secretion
    101088970 (PRKCB)
   04972 Pancreatic secretion
    101088970 (PRKCB)
   04973 Carbohydrate digestion and absorption
    101088970 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101088970 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101088970 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101088970 (PRKCB)
   04727 GABAergic synapse
    101088970 (PRKCB)
   04725 Cholinergic synapse
    101088970 (PRKCB)
   04728 Dopaminergic synapse
    101088970 (PRKCB)
   04726 Serotonergic synapse
    101088970 (PRKCB)
   04720 Long-term potentiation
    101088970 (PRKCB)
   04730 Long-term depression
    101088970 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    101088970 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101088970 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088970 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088970 (PRKCB)
   05206 MicroRNAs in cancer
    101088970 (PRKCB)
   05205 Proteoglycans in cancer
    101088970 (PRKCB)
   05207 Chemical carcinogenesis - receptor activation
    101088970 (PRKCB)
   05231 Choline metabolism in cancer
    101088970 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101088970 (PRKCB)
   05214 Glioma
    101088970 (PRKCB)
   05223 Non-small cell lung cancer
    101088970 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101088970 (PRKCB)
   05161 Hepatitis B
    101088970 (PRKCB)
   05171 Coronavirus disease - COVID-19
    101088970 (PRKCB)
   05164 Influenza A
    101088970 (PRKCB)
   05163 Human cytomegalovirus infection
    101088970 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101088970 (PRKCB)
   05140 Leishmaniasis
    101088970 (PRKCB)
   05143 African trypanosomiasis
    101088970 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101088970 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    101088970 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101088970 (PRKCB)
   05032 Morphine addiction
    101088970 (PRKCB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101088970 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101088970 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101088970 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101088970 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101088970 (PRKCB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101088970 (PRKCB)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101088970 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C Kinase-like CEP76-C2 ABC1 APH
Other DBs
NCBI-GeneID: 101088970
NCBI-ProteinID: XP_019676349
LinkDB
Position
E3:complement(25394820..25728893)
AA seq 644 aa
MTYLKQEILFFKAWKGVGIFWCSESKAELKFLIKYGNFRVCCFVVHKRCHEFVTFSCPGA
DKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPS
LCGTDHTERRGRIYIQAHIEREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESK
QKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKA
GVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTTNTISKLD
NNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMV
EKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAE
IAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIA
PEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAV
AICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENF
DRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgacatacctgaagcaggagatcctgtttttcaaagcctggaaaggggtaggaattttc
tggtgtagtgagagtaaagcagaattaaagtttctcatcaaatacggcaacttcagagtc
tgctgtttcgtcgtgcacaagcggtgccatgaatttgtcactttctcctgcccaggcgct
gacaaaggcccagcctctgatgacccccggagcaaacacaagtttaagatccacacatac
tccagccccacgttttgtgaccactgcgggtcactgctgtatggactcatccaccagggg
atgaaatgtgacacctgcatgatgaacgtgcacaagcgttgcgtgatgaacgtccccagc
ctgtgcggcacagaccacactgagcgccgaggccgcatctacatccaggcgcacatcgag
agggaagtcctcatcgtcgtcgtaagagatgctaaaaaccttgtacctatggaccccaat
ggcttgtcagacccttatgtgaaactgaaactgattcctgaccccaagagcgagagcaag
cagaagaccaaaaccatcaaatgctccctcaaccccgagtggaatgagacattcagattc
caactgaaagaatcggacaaagacagaaggctgtctgtagagatttgggattgggatctg
accagcaggaacgacttcatgggatctttgtcgtttgggatttccgaactgcagaaagcc
ggtgttgatggctggtttaagctgctgagccaggaggaaggcgagtacttcaatgtgccc
gtgccgccagagggaagtgaagggaatgaagaactacggcagaaattcgagagggccaag
atcggtcaggggaccaaggctccagaagaaaagacgaccaacaccatatccaaacttgac
aacaatgggaacagagaccgaatgaaactgaccgattttaacttcctgatggtgctcggg
aaaggaagctttggcaaggtcatgctctcagagcggaaaggcacagatgagctctatgcc
gtgaagatcctgaagaaggacgtcgtgatccaagatgatgatgtggaatgcacgatggtg
gagaagcgggtgctggccctgcccgggaagccgccgttcctgacccagctccattcctgc
ttccagaccatggaccgcctgtactttgtgatggagtacgtgaacgggggtgacctcatg
taccacatccaacaagttggccggtttaaggagcctcatgctgtattttacgctgccgaa
attgccatcggtctgttcttcttacagagcaagggcatcatttaccgtgacctcaaactt
gacaatgtgatgctggattcagagggccacatcaagattgctgattttggcatgtgtaag
gaaaacatctgggatggggtgaccaccaagacattctgtggcactccagactacatcgcc
cctgagataattgcttatcagccctatgggaagtccgtggattggtgggcatttggagtc
ctgctgtatgaaatgttagctggccaggcaccctttgaaggggaggatgaggacgagctc
ttccagtccatcatggaacacaacgtggcttacccaaagtccatgtccaaggaagctgtg
gccatctgcaaagggctgatgaccaaacacccgggcaaacgtctgggttgtggacctgaa
ggtgaacgtgacatcaaagagcatgcatttttccggtatattgattgggagaaacttgaa
cgcaaagagatccagcccccgtataagccaaaagcctgtgggcgaaatgctgaaaacttc
gaccggtttttcacccgccatccacccgtcctaacacctcccgaccaggaagtcatcagg
aatattgaccaatcagaattcgaaggattttcctttgttaactctgaatttttaaaacct
gaagtcaagagctaa

DBGET integrated database retrieval system