KEGG   Felis catus (domestic cat): 101082249
Entry
101082249         CDS       T02385                                 
Symbol
HSP90B1
Name
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04657  IL-17 signaling pathway
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca05132  Salmonella infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05215  Prostate cancer
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101082249 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101082249 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101082249 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101082249 (HSP90B1)
   04918 Thyroid hormone synthesis
    101082249 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082249 (HSP90B1)
   05207 Chemical carcinogenesis - receptor activation
    101082249 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101082249 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101082249 (HSP90B1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101082249 (HSP90B1)
   05418 Fluid shear stress and atherosclerosis
    101082249 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101082249 (HSP90B1)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP90
   101082249 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 101082249
NCBI-ProteinID: XP_019690982
Ensembl: ENSFCAG00000014077
UniProt: M3WK11
LinkDB
Position
B4:126278201..126296673
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEDSDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTTEDTEQDEEE
EMDAGADEEEQETVKKSTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctactgaccttcgggtcagtccgg
gctgatgatgaagtggacgtggatggtacagtggaagaggatctgggcaaaagtagagaa
ggctcaaggacagatgatgaagttgtgcagagagaggaagaagctattcagttggatgga
ttaaatgcatcccaaataagagaacttagagagaaatcagaaaaatttgccttccaagct
gaagttaatcgaatgatgaaacttattattaattcattgtataaaaataaagagattttc
ttgagagaactgatttcaaatgcttctgacgctttagataagataaggttaatatcactg
actgatgaaaatgctcttgctggaaatgaggaactaactgtcaaaattaagtgtgacaag
gagaagaacctgctgcatgtgacagacaccggtgtagggatgacccgggaagagttggtt
aaaaaccttggcaccatagccaaatctggaaccagcgagttcttaaacaaaatgactgag
gcacaagaagatggccagtcgacttctgaattgatcggccagtttggtgttggcttctat
tctgccttcctcgtggctgacaaggttattgtcacgtcgaaacacaacaatgatacccag
cacatctgggaatctgactccaatgaattttctgtgattgctgacccaagaggaaacacc
ctgggacggggaacaacaattacccttgttttaaaagaagaagcatctgattaccttgaa
ttagatacaattaaaaatctcgtcaagaaatattcacagtttataaacttccctatttat
gtgtggagcagcaagactgaaactgttgaggaacccatggaagaagaagaagcagcgaaa
gaagaaaaggaagattctgatgatgaagctgcagtggaagaagaagaagaggaaaaaaaa
ccaaaaaccaaaaaagttgaaaagactgtctgggattgggaacttatgaatgacatcaaa
ccgatctggcagagaccatcaaaagaagtagaagatgatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcctacatccactttactgctgaaggggaa
gttaccttcaaatccattttattcgtacctacatctgctcctcgtggtctgtttgatgaa
tatggatcgaagaagagtgattacattaagctctatgtgcgccgagtattcatcacagac
gacttccatgacatgatgcccaagtaccttaatttcgtcaagggtgttgtggactcagat
gatctccccttgaacgtttcccgggaaactcttcaacaacataaactgcttaaggtgatt
agaaagaagcttgtccgtaaaactctggacatgatcaagaagattgctgatgagaagtac
aatgatactttttggaaagaattcggtaccaacatcaagctcggtgtgattgaagaccac
tcaaatcgaacacgtcttgcaaaactccttaggttccagtcttctcatcatccaagtgac
attacgagtctagatcagtatgtggaaagaatgaaggagaaacaagacaaaatctacttc
atggctgggtccagcaggaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagtgatttatctcacagaacctgtggacgaatactgcattcaggctctt
ccggagtttgatgggaaaaggttccagaatgttgccaaggaaggagtgaaatttgatgaa
agtgagaaaactaaggagagtcgtgaagcagttgagaaagaatttgagcctctgctcaat
tggatgaaagataaagctctcaaggacaagattgaaaaggccgtggtatctcaacgtctg
acagagtctccttgtgctcttgtggccagccagtatgggtggtctggcaacatggagaga
atcatgaaagctcaagcctaccagacgggcaaggacatctctacaaattactatgccagc
cagaagaaaacatttgaaattaatcccagacatcccctgatcaaagacatgcttcgacga
gtgaaggaagatgaagatgataagaccgtttcagatcttgctgtggttttgtttgaaacg
gcaacactacggtcaggatatctgttaccagacactaaagcatatggagatcgaatagaa
agaatgcttcgcctcagtttaaacattgaccctgatgcaaaggtggaagaagaacccgag
gaagaacctgaagaaacaacagaggacaccacagaagacacagagcaggacgaagaagaa
gaaatggatgcaggagcagatgaagaagaacaggaaacagtaaagaaatctacagctgaa
aaagatgaattataa

KEGG   Felis catus (domestic cat): 101094857
Entry
101094857         CDS       T02385                                 
Symbol
HSP90AA1
Name
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04612  Antigen processing and presentation
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04659  Th17 cell differentiation
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca05132  Salmonella infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05215  Prostate cancer
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101094857 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101094857 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101094857 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101094857 (HSP90AA1)
   04612 Antigen processing and presentation
    101094857 (HSP90AA1)
   04659 Th17 cell differentiation
    101094857 (HSP90AA1)
   04657 IL-17 signaling pathway
    101094857 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101094857 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    101094857 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094857 (HSP90AA1)
   05207 Chemical carcinogenesis - receptor activation
    101094857 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101094857 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101094857 (HSP90AA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101094857 (HSP90AA1)
   05418 Fluid shear stress and atherosclerosis
    101094857 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101094857 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101094857 (HSP90AA1)
   04131 Membrane trafficking [BR:fca04131]
    101094857 (HSP90AA1)
   03051 Proteasome [BR:fca03051]
    101094857 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101094857 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094857 (HSP90AA1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101094857 (HSP90AA1)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP90
   101094857 (HSP90AA1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101094857 (HSP90AA1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101094857 (HSP90AA1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101094857 (HSP90AA1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101094857 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 101094857
NCBI-ProteinID: XP_023111815
Ensembl: ENSFCAG00000000814
LinkDB
Position
B3:complement(146475540..146481306)
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcccgaggaaacccagacccaagaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggagatcgcccagttgatgtccctgatcatcaacactttctactcgaat
aaagagattttcctgcgcgagctgatttccaactcgtccgatgccctggacaaaatcaga
tacgagagcttgactgatcccagcaagttagattccgggaaagagctgcacattaatctc
attccaaacaagcaagatcgaaccctcactattgtggataccgggattggcatgaccaag
gccgatttgatcaataatctcggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggcgcagatatttctatgatcggccagtttggcgtcgggttctattct
gcctatttggttgccgagaaagtgacggtgatcaccaagcataacgatgatgagcagtac
gcctgggagtcttctgcaggagggtcgttcacagtcaggactgatacaggtgaacctatg
ggtcgaggaacaaaggttatcttgcatctgaaagaagaccaaacagaatacctggaggaa
agaagaataaaggagattgtgaagaaacactcccagtttatcggctatcctatcactctc
tttgtggagaaggagcgggataaagaggtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagaaaaagaaaaggaagagaaggagtccgatgacaagcctgaaatcgaagat
gttggttccgatgaggaggaggaggaaaagaaggacggagacaagaagaagaagaagaag
atcaaggagaagtacatcgatcaagaagaactgaacaagaccaaacctatttggaccaga
aaccctgacgacatcactaacgaagagtacggagaattttacaagagcttgaccaacgac
tgggaggatcacttggcagtgaagcatttttcggtcgaaggacagttggaattcagagcc
ctgctttttgtcccaagacgtgctccctttgacctgtttgaaaacaggaagaaaaagaac
aacatcaagctgtatgtgcgcagagttttcatcatggataactgtgaggagctgatcccg
gaatacctgaatttcattagaggcgtggtggactccgaggatcttcccctgaacatttcc
cgggagatgttgcagcagagcaagatcttaaaagtcatccgcaagaatttggtcaaaaag
tgcttagaactcttcaccgaactggccgaagacaaagagaactacaagaagttttacgag
cagttctcgaagaacattaagctcggaatccacgaggactcccagaaccggaagaagctg
tcggagctgttgcgctactacacgtctgcctctggtgacgagatggtgtctctcaaggac
tattgcaccaggatgaaggagaaccagaagcacatctactacatcacaggggagaccaag
gaccaggtggcgaactcggccttcgtggagcgtcttcggaagcacggtctggaggtgatc
tatatgatcgagccgatcgatgagtactgtgtccaacagctgaaggaatttgaggggaag
actttagtgtccgtcaccaaagagggcttggaacttccagaagatgaagaagagaaaaag
aaacaggaagagaagaagacaaagtttgaaaacctgtgcaagatcatgaaggacatcttg
gagaaaaaagtggaaaaggtggttgtgtcaaaccgactggtgacctccccgtgctgcatt
gtcacgagcacgtacggctggacggcgaacatggagaggatcatgaaggcccaggcccta
agggacaactccaccatgggctacatggcagcgaagaagcacctggagatcaaccccgac
cactccatcatcgagactttgcggcagaaggcggaggcggacaagaacgacaagtccgtg
aaagacctggtcatcctgctctacgaaaccgcgctcctgtcctctggcttcagtctggaa
gacccacagacacacgctaaccggatctacaggatgatcaaacttggtctgggtatcgac
gaagatgaccccaccgccgacgacagcagtgctgcggtgaccgaggagatgccacccctg
gaaggcgacgacgacacgtcgcgcatggaagaagtcgactga

KEGG   Felis catus (domestic cat): 101095825
Entry
101095825         CDS       T02385                                 
Symbol
HSP90AB1
Name
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04612  Antigen processing and presentation
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04659  Th17 cell differentiation
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca05132  Salmonella infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05215  Prostate cancer
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101095825 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101095825 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101095825 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101095825 (HSP90AB1)
   04612 Antigen processing and presentation
    101095825 (HSP90AB1)
   04659 Th17 cell differentiation
    101095825 (HSP90AB1)
   04657 IL-17 signaling pathway
    101095825 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101095825 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    101095825 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095825 (HSP90AB1)
   05207 Chemical carcinogenesis - receptor activation
    101095825 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101095825 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095825 (HSP90AB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095825 (HSP90AB1)
   05418 Fluid shear stress and atherosclerosis
    101095825 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101095825 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101095825 (HSP90AB1)
   04131 Membrane trafficking [BR:fca04131]
    101095825 (HSP90AB1)
   03051 Proteasome [BR:fca03051]
    101095825 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101095825 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101095825 (HSP90AB1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101095825 (HSP90AB1)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP90
   101095825 (HSP90AB1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101095825 (HSP90AB1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101095825 (HSP90AB1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101095825 (HSP90AB1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101095825 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Cofac_haem_bdg
Other DBs
NCBI-GeneID: 101095825
NCBI-ProteinID: XP_023109787
Ensembl: ENSFCAG00000009764
LinkDB
Position
B2:44983470..44987942
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacatttgccttccaggcagaa
attgcccaactcatgtccctcatcatcaataccttttattccaacaaggaaattttcctt
cgggagttgatcagtaacgcttctgatgccttggacaagattcggtatgagagcctgaca
gacccttccaagctggacagtggtaaagagctcaaaattgacatcatccccaacccccag
gaacgcactctgactctagtggacacaggcattggcatgaccaaagccgatctcataaat
aatttggggaccattgccaagtcgggcactaaagcattcatggaggctctccaggctggt
gcggacatctccatgattggacaatttggtgttggcttttattctgcttatctggtggca
gagaaagtggttgttatcacaaagcacaacgatgatgagcagtatgcctgggagtcttct
gctgggggctccttcactgtacgtgcagaccatggtgagcccattggccggggcaccaaa
gtgatcctccatcttaaagaagaccagacagaatatttagaggagagacgtgtcaaagaa
gtggtgaagaagcactcacagttcataggctatcccatcactctttatctggagaaggaa
cgagagaaagaaatcagtgatgatgaggcagaggaggagaaaggtgagaaagaagaggaa
gataaagatgatgaggagaagcccaagattgaagatgtgggctcagatgaggaggatgat
agtgggaaggacaagaagaagaaaacaaagaagattaaggagaagtacattgatcaggaa
gaactgaacaagaccaagcccatttggaccagaaaccctgacgacatcacccaggaggaa
tatggagagttttacaagagccttacgaatgactgggaagaccacttggcagtcaagcac
ttctctgtggaaggtcagctggaattcagggcattgctgttcatcccccgtcgggctcct
tttgacctttttgagaacaagaagaaaaagaacaacattaagctctatgtccgccgtgtg
tttatcatggacagctgtgatgagttgataccggagtatctcaatttcatccgtggtgtg
gtggactctgaggacttgcccctaaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaggtcattcgcaaaaacatcgtaaagaagtgccttgagctcttctctgaactggca
gaagacaaggagaactataagaaattctatgaggcattttctaaaaacctgaagcttgga
atccatgaggactccactaatcggcgccgtctttctgagctgctgcgttatcacacctcc
cagtctggagatgagatgacttccctttcggagtatgtctctcgcatgaaggagacccag
aagtccatctattacatcactggcgagagcaaagagcaggttgccaactccgcttttgtg
gagcgggtgcggaagcggggcttcgaggtagtgtatatgactgagcctatcgatgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagtctcgtctccgttaccaaggagggc
ctggagctacctgaggatgaagaggagaaaaagaaaatggaagagagcaaggccaagttt
gagaacctctgcaaacttatgaaagaaatactggacaagaaggttgagaaggtgaccatc
tcaaacaggctagtgtcttcaccctgctgcattgtgacgagcacctacggctggacggcc
aacatggagcggatcatgaaagcccaggcacttcgggacaactctacaatgggttatatg
atggccaaaaagcacctggagattaatcccgaccaccccattgtggagacactacggcag
aaggcagaggcggacaagaatgacaaggctgtcaaggacctggtggtgctcctgtttgaa
actgcactgctctcttctggcttctcactggaggatccccagacccactccaaccgaatt
taccgcatgatcaagctaggcctgggtattgacgaagacgaagtaactgcagaggaaccc
agtgctgctgttcctgatgagatccctccccttgagggtgatgaggatgcatcccgcatg
gaagaagtagattag

DBGET integrated database retrieval system