KEGG   Felis catus (domestic cat): 101082365
Entry
101082365         CDS       T02385                                 
Symbol
MYL10
Name
(RefSeq) myosin regulatory light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101082365 (MYL10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101082365 (MYL10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101082365 (MYL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101082365 (MYL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101082365 (MYL10)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101082365 (MYL10)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 101082365
NCBI-ProteinID: XP_023102519
Ensembl: ENSFCAG00000018080
LinkDB
Position
E3:complement(8503461..8514608)
AA seq 173 aa
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFCCLGCV
TSSCRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGF
VKADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRSLCYIITHGEEKD
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcaccgagaagggcccgcaagagagcggagggcggagccagctccaatgtcttctcc
atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac
cgggatggcttcatcgacaaggaggacctgagagacaccttttgctgccttgggtgcgtg
accagcagctgccgcatcaacgtgaagaacgaggagctggaggccatggtgaaggaggcc
cccgggcccatcaacttcaccgtcttcctgaccatgttcggggagaagctgaagggaacg
gacccagaggagaccattctccacgccttcaaggtgtttgacaccgaagggaaaggtttc
gtcaaggctgatttcatcaaagagaaactcatgacccaggcggaccggttcagtgaggag
gaggtcaagcagatgttcgcggctttccctccagacgtgtgtggcaacctggactacagg
agcctgtgctacatcatcacccatggtgaagagaaggactag

KEGG   Felis catus (domestic cat): 101085247
Entry
101085247         CDS       T02385                                 
Name
(RefSeq) myosin regulatory light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04530  Tight junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101085247
   04530 Tight junction
    101085247
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101085247
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101085247
   04670 Leukocyte transendothelial migration
    101085247
  09158 Development and regeneration
   04360 Axon guidance
    101085247
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101085247
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101085247
   04147 Exosome [BR:fca04147]
    101085247
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101085247
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   101085247
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF2666 DUF3741 SPARC_Ca_bdg 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 101085247
NCBI-ProteinID: XP_011286390
Ensembl: ENSFCAG00000022871
UniProt: M3XE65
LinkDB
Position
D3:complement(42846050..42863942)
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgtccccagcgcgcaacatcc
aacgtgtttgccatgtttgaccagtcacagattcaggaattcaaagaggccttcaacatg
attgatcagaacagagatggtttcattgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatccaaccgatgcataccttgatgccatgatgaatgaggctccggggccc
ataaatttcaccatgttccttacgatgtttggtgagaaattaaacggcacagatccggaa
gatgtcatcagaaatgcttttgcttgctttgatgaagaagcaactggcaccatccaggaa
gactacctgagagagctgctgacaacgatgggagaccggtttacggatgaggaggtggac
gagctgtacagagaagcgcctatcgacaaaaaggggaatttcaattacatcgagttcacg
cgcatccttaaacatggagcaaaagacaaagatgattga

KEGG   Felis catus (domestic cat): 101085837
Entry
101085837         CDS       T02385                                 
Name
(RefSeq) myosin regulatory light polypeptide 9 isoform X2
  KO
K12757  myosin regulatory light chain 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04530  Tight junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101085837
   04530 Tight junction
    101085837
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101085837
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101085837
   04670 Leukocyte transendothelial migration
    101085837
  09158 Development and regeneration
   04360 Axon guidance
    101085837
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101085837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101085837
   04147 Exosome [BR:fca04147]
    101085837
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101085837
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   101085837
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF2666 DUF3741 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 101085837
NCBI-ProteinID: XP_003995089
Ensembl: ENSFCAG00000029783
UniProt: A0A5F5XKE1
LinkDB
Position
D3:complement(42868897..42878931)
AA seq 172 aa
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaagggcaaagaccaagaccaccaagaagcgcccgcagcgcgcaacatcc
aatgtgtttgccatgtttgaccagtcccagattcaggaattcaaagaggccttcaacatg
attgatcagaacagagatggattcattgacaaggaagatttgcatgatatgcttgcctcc
ctggggaaaaatccaactgatgagtatctggatgccatgatgaatgaggctccagggccc
ataaatttcaccatgtttctcacgatgttcggtgagaagttaaatggcacagatccagaa
gatgtcatcagaaatgcttttgcttgctttgatgaagaagcaactggcaccatccaggaa
gactacctgagagagctgctgacaacgatgggagaccggtttacggatgaggaggtggac
gagctgtacagagaagcgcctatcgacaaaaaggggaatttcaattacatcgagttcacg
cgcatccttaaacatggagcaaaagacaaagatgattga

KEGG   Felis catus (domestic cat): 101094812
Entry
101094812         CDS       T02385                                 
Symbol
MYLPF
Name
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform
  KO
K12758  fast skeletal myosin light chain 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101094812 (MYLPF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101094812 (MYLPF)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101094812 (MYLPF)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101094812 (MYLPF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101094812 (MYLPF)
   04147 Exosome [BR:fca04147]
    101094812 (MYLPF)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101094812 (MYLPF)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101094812 (MYLPF)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 101094812
NCBI-ProteinID: XP_003998706
Ensembl: ENSFCAG00000013538
UniProt: M3WJ09
LinkDB
Position
E3:complement(21060214..21062504)
AA seq 170 aa
MAPKKARRRAAAEGGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR
LNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDHEGKGTIKKQF
LEELLTTQCDRFSPEEIRNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaggagaagggcggcagcagagggcggaagctccaatgtcttc
tccatgttcgaccagactcagatccaagagttcaaggaggccttcacggtaatcgaccag
aaccgtgatggcattatcgacaaggaagatctgcgggacaccttcgcagccatggggcgc
ctcaatgtgaagaatgaggagctagatgccatgatgaaggaagccagtggtcccatcaac
ttcaccgtcttcctgaccatgtttggagagaagcttaaaggtgctgatcctgaggacgtg
atcactggagccttcaaggtcctggatcatgaggggaagggcaccatcaagaagcagttc
ctggaggagctgcttaccacgcagtgcgaccgcttctccccggaagagatcaggaacatg
tgggcagcgttcccccccgacgtgggaggcaatgtagactacaagaacatctgctacgtc
atcacgcatggcgacgccaaggaccaggagtag

KEGG   Felis catus (domestic cat): 101095326
Entry
101095326         CDS       T02385                                 
Symbol
MYL7
Name
(RefSeq) myosin regulatory light chain 2, atrial isoform
  KO
K12754  myosin regulatory light chain 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101095326 (MYL7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101095326 (MYL7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101095326 (MYL7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095326 (MYL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095326 (MYL7)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101095326 (MYL7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 CHCH EF-hand_9
Other DBs
NCBI-GeneID: 101095326
NCBI-ProteinID: XP_019681655
UniProt: M3WKK2
LinkDB
Position
A2:complement(62431163..62433385)
AA seq 175 aa
MASRKAGTRGKAAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILNAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGDVDYKSLCYIITHGDEKEE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggccgcagctgccaagcaggcccagcga
ggctcttctaacgtcttttccatgttcgagcaagcccagatccaggaattcaaggaggcc
ttcagctgcattgaccagaaccgtgatggcatcatctgcaagtcagaccttcgggagacc
tactcccagctcgggaaggtgagcgtcccggaagaggaactggatgccatgctgcaggaa
gggaagggtcccatcaacttcacggtcttcctcacgctcttcggggagaagctcaacggg
acagaccccgaggaagccatcctgaacgccttccgcatgtttgaccccagtggcaagggc
gtggtgaacaaggatgagttcaaacagcttctcctgacccaggcagacaagttctctccg
gctgaggtggagcagatgttcgccctgacgcccatggacctggcgggggacgtcgactac
aagtctctgtgctacatcatcacccatggggatgagaaagaggagtga

KEGG   Felis catus (domestic cat): 101097882
Entry
101097882         CDS       T02385                                 
Symbol
MYL9
Name
(RefSeq) myosin regulatory light polypeptide 9 isoform X1
  KO
K12755  myosin regulatory light chain 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04270  Vascular smooth muscle contraction
fca04360  Axon guidance
fca04510  Focal adhesion
fca04530  Tight junction
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101097882 (MYL9)
   04022 cGMP-PKG signaling pathway
    101097882 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097882 (MYL9)
   04530 Tight junction
    101097882 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101097882 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101097882 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101097882 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101097882 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    101097882 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101097882 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101097882 (MYL9)
   04147 Exosome [BR:fca04147]
    101097882 (MYL9)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101097882 (MYL9)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101097882 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH DUF3741 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 101097882
NCBI-ProteinID: XP_003983604
Ensembl: ENSFCAG00000026889
UniProt: A0A2I2U033
LinkDB
Position
A3:complement(23097891..23104876)
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgagccaaggccaaaaccaccaagaagcggccacagcgggccacatct
aatgtcttcgcgatgtttgaccagtcccagatccaggagtttaaggaggccttcaatatg
attgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcctcg
ctggggaagaaccccacagatgagtaccttgagggcatgatgagcgaggccccggggccc
atcaacttcaccatgtttctcaccatgtttggggagaagctgaacggcacagatcctgag
gatgtgatccgaaatgccttcgcctgcttcgacgaggaggcctcaggttttattcacgag
gaccacctacgggagctgcttaccaccatgggcgaccgcttcacagatgaagaagtggac
gagatgtaccgagaggcacccattgataagaaaggcaacttcaactatgtggagttcacc
cgcatcctcaagcatggggccaaggacaaggacgactag

KEGG   Felis catus (domestic cat): 101101169
Entry
101101169         CDS       T02385                                 
Symbol
MYL2
Name
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04530  Tight junction
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
fca05410  Hypertrophic cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101101169 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101169 (MYL2)
   04530 Tight junction
    101101169 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101101169 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101101169 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101101169 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    101101169 (MYL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101101169 (MYL2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101101169 (MYL2)
   05414 Dilated cardiomyopathy
    101101169 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101101169 (MYL2)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101101169 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EFhand_Ca_insen EF-hand_5 EF-hand_11
Other DBs
NCBI-GeneID: 101101169
NCBI-ProteinID: XP_003994712
Ensembl: ENSFCAG00000011170
UniProt: M3WEL6
LinkDB
Position
D3:complement(8973095..8981084)
AA seq 166 aa
MAPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEMDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacctaagaaagccaagaagagagcagaaggtgccaattccaacgtgttctctatg
tttgaacagacccagatccaggaatttaaggaggccttcaccatcatggaccagaacagg
gatggcttcatcgacaagaatgatttgagggacacgtttgctgctcttgggcgtgtgaat
gtgaagaatgaagaaattgatgaaatgctcaaggaagctccaggtccaattaactttact
gtgttcctaacgatgtttggggagaaacttaagggggcagaccccgaggagaccattctc
aacgcattcaaagtgtttgaccccgaaggcaaaggggtgctcaaggctgattacgttcgg
gagatgctgaccacacaggcagagagattttccaaagaggagatggaccagatgttcgct
gccttcccccctgatgtgaccggcaatttggactataagaacctggtgcacatcatcacc
cacggagaagagaaggactga

KEGG   Felis catus (domestic cat): 493974
Entry
493974            CDS       T02385                                 
Symbol
MYL5
Name
(RefSeq) myosin light chain 5
  KO
K12753  myosin regulatory light chain 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493974 (MYL5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493974 (MYL5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    493974 (MYL5)
  09158 Development and regeneration
   04360 Axon guidance
    493974 (MYL5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493974 (MYL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    493974 (MYL5)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     493974 (MYL5)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4
Other DBs
NCBI-GeneID: 493974
NCBI-ProteinID: NP_001009874
Ensembl: ENSFCAG00000018168
UniProt: P41691
LinkDB
Position
B1:complement(208062838..208066323)
AA seq 173 aa
MASRKTKKKEGGGLRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNIKDDELDAMLKEASGPINFTMFLNMFGAKLTGTDAEETILNAFKMLDPEGKGSI
NKDYIKPLLMSHADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTHGEEKEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaaggggggggccttcgggcccagagagcatca
tccaacgtcttttccaacttcgagcagacccagatccaggagttcaaggaggcattcacg
ctgatggatcagaaccgagatggctttattgacaaggaggatctgaaggacacctatgcc
tccctgggcaaaaccaacatcaaggatgatgagttggatgccatgctcaaggaggcctcg
ggacccatcaacttcaccatgttcctgaatatgtttggggcgaagctgacgggtacggat
gccgaagagaccatcctaaatgccttcaagatgctggatcctgaaggcaaaggcagcatc
aacaaggactacatcaagccgctgttgatgtctcacgcagacaagatgaccgctgaagag
gttgaccagatgttccagtttgccaccatcgatgctgcaggcaacctggactacaaggca
ctgagctacgtgctcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system