Felis catus (domestic cat): 101082491 Help Entry 101082491         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101082491  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101082491   09163 Immune disease    05322 Systemic lupus erythematosus     101082491   09165 Substance dependence    05034 Alcoholism     101082491  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101082491 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101082491 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101082491 NCBI-ProteinID:  XP_003985732 Ensembl:  ENSFCAG00000045635 UniProt:  M3WSM7 LinkDB All DBs Position B2:2721556..2721937 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaagggtgggaagggcctaggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

Felis catus (domestic cat): 101083921 Help Entry 101083921         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101083921  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101083921   09163 Immune disease    05322 Systemic lupus erythematosus     101083921   09165 Substance dependence    05034 Alcoholism     101083921  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101083921 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101083921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101083921 NCBI-ProteinID:  XP_011280379 Ensembl:  ENSFCAG00000052647 UniProt:  M3WSM7 LinkDB All DBs Position B2:complement(3647733..3648081) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggttaa

Felis catus (domestic cat): 101083933 Help Entry 101083933         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101083933  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101083933   09163 Immune disease    05322 Systemic lupus erythematosus     101083933   09165 Substance dependence    05034 Alcoholism     101083933  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101083933 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101083933 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101083933 NCBI-ProteinID:  XP_003985737 Ensembl:  ENSFCAG00000045765 UniProt:  M3WSM7 LinkDB All DBs Position B2:2752041..2752573 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctga

Felis catus (domestic cat): 101084193 Help Entry 101084193         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084193  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101084193   09163 Immune disease    05322 Systemic lupus erythematosus     101084193   09165 Substance dependence    05034 Alcoholism     101084193  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084193 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101084193 NCBI-ProteinID:  XP_023110468 Ensembl:  ENSFCAG00000046263 LinkDB All DBs Position B2:complement(2754251..2757779) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

Felis catus (domestic cat): 101084708 Help Entry 101084708         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084708  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101084708   09163 Immune disease    05322 Systemic lupus erythematosus     101084708   09165 Substance dependence    05034 Alcoholism     101084708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084708 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084708 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101084708 NCBI-ProteinID:  XP_044914458 Ensembl:  ENSFCAG00000046199 LinkDB All DBs Position B2:3687185..3687589 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

Felis catus (domestic cat): 101087478 Help Entry 101087478         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101087478  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101087478   09163 Immune disease    05322 Systemic lupus erythematosus     101087478   09165 Substance dependence    05034 Alcoholism     101087478  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101087478 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101087478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101087478 NCBI-ProteinID:  XP_023109351 Ensembl:  ENSFCAG00000042515 LinkDB All DBs Position B2:3616105..3616551 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgaggcaaaggcgggaagggtctgggcaaagggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggtctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctga

Felis catus (domestic cat): 101088423 Help Entry 101088423         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101088423  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101088423   09163 Immune disease    05322 Systemic lupus erythematosus     101088423   09165 Substance dependence    05034 Alcoholism     101088423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101088423 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101088423 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101088423 NCBI-ProteinID:  XP_006935130 Ensembl:  ENSFCAG00000023368 UniProt:  M3WSM7 LinkDB All DBs Position C1:104638834..104639259 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcggggagaggaaagggcggcaaaggcttgggcaaggggggtgccaagcgccaccgc aaagttttgagagacaacatccaaggcatcaccaagccggcaattcggcgccttgcccgg cgtggaggagtcaagcggatctccggcctcatctacgaggagacccggggcgtgctgaag gttttcctggaaaacgtcattcgggatgcagtcacctacactgagcacgccaagcgcaag acggtcacggctatggacgtagtgtatgccctgaagcgccagggacgcaccctgtatggt ttcggaggctaa

Felis catus (domestic cat): 101089767 Help Entry 101089767         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101089767  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101089767   09163 Immune disease    05322 Systemic lupus erythematosus     101089767   09165 Substance dependence    05034 Alcoholism     101089767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101089767 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101089767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101089767 NCBI-ProteinID:  XP_006931453 Ensembl:  ENSFCAG00000052591 UniProt:  M3WSM7 LinkDB All DBs Position B2:complement(3666279..3666676) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

Felis catus (domestic cat): 101092762 Help Entry 101092762         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101092762  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101092762   09163 Immune disease    05322 Systemic lupus erythematosus     101092762   09165 Substance dependence    05034 Alcoholism     101092762  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101092762 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101092762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101092762 NCBI-ProteinID:  XP_006931456 Ensembl:  ENSFCAG00000053116 UniProt:  M3WSM7 LinkDB All DBs Position B2:complement(3795172..3796784) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc tttgggggctga

Felis catus (domestic cat): 101095347 Help Entry 101095347         CDS       T02385                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101095347  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101095347   09163 Immune disease    05322 Systemic lupus erythematosus     101095347   09165 Substance dependence    05034 Alcoholism     101095347  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101095347 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101095347 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101095347 NCBI-ProteinID:  XP_006933596 UniProt:  M3WSM7 LinkDB All DBs Position B4:complement(48592463..48592881) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgggaaagggggcaaagggctgggaaaaggaggcgccaagcgccaccgg aaggtcttacgggacaacatccagggtattacgaagcccgccatccgccggctggcccgc cgagggggtgtcaagcgcatttcgggactcatctatgaggagacccggggagtgcttaaa gtatttctggagaacgtgatccgcgatgcagtgacttacacggagcacgccaagcgcaag accgtcacggcaatggacgtggtgtacgcgttgaaacgccagggccgcacgttgtatggc ttcggtggctga

DBGET integrated database retrieval system