KEGG   Felis catus (domestic cat): 101082534
Entry
101082534         CDS       T02385                                 
Symbol
WIPF2
Name
(RefSeq) WAS/WASL-interacting protein family member 2 isoform X1
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101082534 (WIPF2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101082534 (WIPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082534 (WIPF2)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101082534 (WIPF2)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 101082534
NCBI-ProteinID: XP_011287456
LinkDB
Position
E1:41187039..41236678
AA seq 440 aa
MPIPPPPPPPPGPPPPPTFNQANTEPPKLSRDEQRGRGALLQDICKGTKLKKVTNVNDRS
APILEKPKGSSGGYGSGAVALQPKGSLFQGGVPKLRPVGAKDGSENLAGKPALQVPSSRA
AAPRPPVSTVSGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPVHSNKALAYNREKPLPPTPGQRLHLGREGPPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLQSNRPPPPARDPPSRGAAPLPPPPMIRNGARDAPPPPPPYRMHGSEPLSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
YPSKTNRAARGAPPLPPILR
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccaattcctcctccccctccaccgccccctggtcctcctccacctcccacttttaat
caggcaaacacagagccgcccaagctgagtagagatgagcagcggggtcgaggtgcccta
ttacaggatatctgcaaagggaccaagctgaagaaggtgaccaatgttaatgatcggagt
gctcccatccttgagaaacccaaaggaagcagtggtggttatggctctggagcagttgcc
ctgcagcccaagggaagtctcttccaagggggagtgccgaagctccgacctgtgggagcc
aaggatggttcagagaacctagctggtaagccagccctacaagtccccagttctcgagct
gctgccccaaggccaccggtgtctacagtcagtgggcgccctcaagatgatacagacagc
agccgagcctcactcccagaactgccccggatgcagagaccatcgttaccggacctctct
aggcctaataccaccagcagtacaggcatgaagcacagcagctctgcccctcctccacca
cccccggggcggcgggccaacgctccccctacacctctgcctgtgcacagcaacaaagcc
ctagcctacaacagagagaaacccttgccgcccacacctggacaaaggctgcaccttggt
cgagagggacctcctgctccacccccagtcaaaccacctccttcccctgtgaatattaga
acgggaccaagtggccagtctctggctcctcctcctccgccttaccgccagcctcctggg
gtccccaatggaccctccagtcccactaacgagtcagcccctgagctgccccagagacac
aattctttgcataggaagacaccggggcctgtcagaggcctagcgcctcctccacccacc
tcagcctctccctcactacagagtaataggccaccacccccagcccgggaccctcccagt
cggggagcagctcctctacccccaccacccatgatccgaaatggtgccagggatgctccc
cctcccccaccaccataccgaatgcatgggtcagaacccctgagccgaggaaagccccca
cctcctccctcaaggacgccagctggaccaccccctcctcctccaccacccctgaggaat
ggccacagagattctattaccactgtccgatctttcttggatgattttgagtcaaagtat
tctttccatccagtagaagactttcctgctccagaagaatataaacactttcaaagaata
tatcccagcaaaacaaaccgagctgcccgtggagccccacctctgccacccattctcagg
tga

KEGG   Felis catus (domestic cat): 101094008
Entry
101094008         CDS       T02385                                 
Symbol
WIPF3
Name
(RefSeq) WAS/WASL-interacting protein family member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094008 (WIPF3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101094008 (WIPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094008 (WIPF3)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101094008 (WIPF3)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 101094008
NCBI-ProteinID: XP_023097941
LinkDB
Position
A2:122995693..123045706
AA seq 606 aa
MADERRSREIKYLLRVAQRVESLHFVTCMLSLVPPGLQGCSYGRDGWDMPSKPKTASDVF
LLAALHAVPPGRLTLFREESAKGGQKLKTPAFRPAASGGMEKESRGLTLRKKEVGQHGPP
TGGSMLPDEGVSADCVITCGSNRIPLIPLQVGTDASSLRKADPKGRSALLADIQQGTRLR
KVTQINDRSAPQIESSKGGNKEGGGSANSRGGSTPPALGDLFAGGFPVLRPAGQRDAAGG
KTGQAPGSRAPSPRLPIKTISGPLNPPASPRLGSASEVHGAARTVPPRPSMPAPPPPTPP
PPPPPLPPPLPPSSPTKTPLVSPPGPPTKGNPPGAVPPLPSVPPPPPPPPPPTPPPLPLA
SVLSDKAVKPQLTPLHLPPIPPPLPLLPPCGYPGLSADATSPAQDVREPPAPPPPPPPPP
LYASCTPRSSVPAPPLPGANNSSEAPPPLPPKSPSFQAQPPKSSVQALPTPPAPPGSQTF
VQKRPGRGPGTSGGKLNPPPAPPARSPTTELSSRSQQAPAWTPTPQPGGQLWNGSLHIID
DFESKFTFHTVEDFPPPDEYKPSQKSYPSKIPRSRTPGPWLHAEAAGQSSDDIKGRNSQL
SLKTLR
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggcggacgaacggcggtccagagagattaagtacttgctcagagtcgcacaacgggtg
gagtctttgcacttcgtcacctgcatgctgtcccttgtaccgcccggcctccagggctgc
agttatggcagagatggctgggacatgccctccaagcccaagacagccagtgacgtgttc
ctgttggctgctttgcacgcagtacctcctggccgactcaccttattccgtgaagagtca
gcaaagggaggccagaagctgaaaacccctgcctttcgccctgcggccagcgggggcatg
gaaaaggagagtagggggctgactcttagaaagaaagaggtgggccagcatggtccaccc
acaggaggttccatgttacctgacgagggagtttcagcggattgtgttattacgtgcggt
tctaatcggatccctcttattcccttacaggtgggtacagacgcttccagcttgagaaag
gcagaccccaaaggtcggagcgctctgttggctgatatccagcagggaactcgcctacgg
aaagtcacacagatcaatgaccgcagtgccccacaaattgagagttctaagggaggcaac
aaagaaggaggaggttctgcaaactctcgaggcggaagcacacccccagccctgggagat
ctgtttgccggtggctttccagtgttgcgtccagcaggccagagggatgcagcaggtggc
aagacagggcaggcccctggctcccgggcgccttctccccggcttcctatcaaaactatc
agtggcccgctgaacccccctgcatctcccaggctaggcagtgcctctgaggtgcacggc
gctgccaggacagtccctcctcgccccagcatgcctgccccaccgcctcctaccccaccc
ccacctcctccacccctgcccccacccctgcccccttcctcccccaccaaaactccgctg
gtgtccccacctggcccacccaccaaagggaaccccccaggggctgtaccccctctcccc
tccgtacctccccctccccctcccccccctcccccaactccacccccccttcccctggcc
tccgttctcagtgacaaggcagtgaagcctcaactaacccccttgcacctaccacccatc
ccacccccactccccctcctcccaccttgtgggtatccagggctcagtgcagatgctacc
agccccgcccaggatgtgcgggagcctcccgccccaccgcccccgccacccccaccccct
ctttatgcctcctgtaccccgaggtcctctgtgcctgcgcctcctttgccaggagctaac
aacagcagtgaagccccgcccccgctgccccccaagtctcccagcttccaggcccagcca
cccaagtccagcgttcaagccttgcctacacctccagcccctccgggatcccagacgttc
gtgcagaagaggcccggacgaggcccagggaccagtgggggaaagctaaatccaccccca
gcaccgcctgcgaggtcacccaccacggagctttccagcagaagccagcaggccccagcc
tggaccccgacaccgcagccgggaggtcagctgtggaacggaagcctgcatatcatcgat
gactttgagtcgaaattcacgtttcatactgtggaagactttcctcctccagatgagtat
aaaccgagccagaagagttaccccagcaagatccccagaagccggacacctggtccctgg
ctccatgccgaggcggcagggcagagctcggatgacatcaaaggcagaaattctcagtta
tctctaaagacactccggtga

KEGG   Felis catus (domestic cat): 101096587
Entry
101096587         CDS       T02385                                 
Symbol
WIPF1
Name
(RefSeq) LOW QUALITY PROTEIN: WAS/WASL-interacting protein family member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101096587 (WIPF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101096587 (WIPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096587 (WIPF1)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101096587 (WIPF1)
SSDB
Motif
Pfam: WH2 GRP
Other DBs
NCBI-GeneID: 101096587
NCBI-ProteinID: XP_023115243
Ensembl: ENSFCAG00000014400
LinkDB
Position
C1:complement(165430969..165557346)
AA seq 499 aa
MPVPPPPAPPPPPTFALANTEKPTLNKSEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGSGGFGGGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRESDSGGSR
LPVLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGAKPESIPP
PVPNTPRPIQSSLHNRGSPPVPGAPRQPSPGPTPPPFPGNRGAAFGGGSIRQTPSGSSSP
FSNRPPLPPTPSRALDDKPPPPPPPVGNRPSVHREAVPPPPPQNSKPPVPSTPRPSSSSQ
APPPPPPPSRPGPPPLPPGSSGSDETPRLPQRNLSLTSSSAPPLPSPGRSGPLPPPPNER
PPPPVRDPPGRSGPLPPPPPISRNGSTSRALPATPQLPSRSGVDSARSGPRPPLPPDRPG
AGAPPPPPPSTSIRNGFQDSSGEDEWESRFYFHPISDLPPPEPYVPTAKSYPSKLARSET
RSGSNRRERGAPPLPPIPR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgcctgtccctccccctccggcgcccccgcccccaccgacgtttgctctggccaataca
gaaaagcctaccttgaataagtccgaacaggctgggagaaatgcccttctgtctgacatc
agcaaagggaagaaactgaagaagactgtcaccaatgacagaagtgcaccgatattggac
aagcccaaaggcgctggtgctggtggcagtggtggctttggtggtggcggaggcggaggt
ggcggtggcggtggcagtttcggagggggtggaccgcctggtttgggaggactgttccag
gctgggatgccgaagctgagatccacagccaacagggagagtgattctggaggaagccga
ctcccagttttgccaccgggaggaagatccacatctgccaaacctttctcacccccaagt
ggcccagggagatttcctgtgccttccccaggccacagaagtggtcccccagagcctcag
aggaaccgaatgcctcccccaaggcccgacgtgggcgcaaagcctgaaagcattccccct
ccagtacctaatacgccaagacccattcaatcaagtctgcacaaccgagggtccccacca
gtgcctggggcccccaggcagcccagccctgggccaactcctccccctttccctggaaac
cgaggtgctgcttttggaggaggctccatacgccagacaccctcaggctcctcctcaccc
ttctccaacaggcctcccctgccccctacccccagcagggccttggatgacaaaccccct
cctccgcctcctccagtgggcaacaggccctccgtccacagggaggcagtcccaccccct
ccccctcagaacagcaagcccccagtgccttctaccccgaggccttcctcctcctcacag
gccccaccgccaccgccgccaccaagcagaccaggccctcctcccctgcctccgggttcc
agtggcagtgatgaaaccccaagactcccacagcggaatctgtcccttacttcttcatct
gcaccccccttaccttcaccaggacgttcgggccctcttcctcccccgcccaatgagaga
ccccctcctccagtgagggacccaccaggcagatcaggccctctcccaccaccccctcca
ataagcagaaatggcagcacatctcgggccctgcctgccaccccccagttgccgtccagg
agtggagtagatagtgccaggagtggacctaggcctcctcttcctcccgacaggcctggt
gctggggcacctccccctcctccaccatcaacatcaattagaaatggcttccaagactct
tcaggtgaagatgagtgggaaagcagattctacttccatccgatttctgatttgccacct
ccagagccatatgtaccaacggccaaaagttatcccagtaaactggcaagaagtgaaacc
cggagtggatccaaccgaagagaaaggggtgcccctccactccctcccatcccgaggtga

DBGET integrated database retrieval system