KEGG   Felis catus (domestic cat): 101083016
Entry
101083016         CDS       T02385                                 
Symbol
NFYB
Name
(RefSeq) nuclear transcription factor Y subunit beta isoform X1
  KO
K08065  nuclear transcription Y subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101083016 (NFYB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101083016 (NFYB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101083016 (NFYB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101083016 (NFYB)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    101083016 (NFYB)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa PAN_3
Other DBs
NCBI-GeneID: 101083016
NCBI-ProteinID: XP_003989237
Ensembl: ENSFCAG00000026471
UniProt: A0A2I2U0F1
LinkDB
Position
B4:complement(126448112..126468295)
AA seq 205 aa
MDGDSATTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIA
NVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAM
STLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTTTDGLSEELTEEAFTNQLPAGLITAD
GQQQNVMVYTTSYQQISGVQQIQFS
NT seq 618 nt   +upstreamnt  +downstreamnt
atggatggcgacagtgctacaacagacgcttctcagctaggcatctctgcggactacatc
ggaggaagccactatgtgatacagccccacgatgatacggaggacagcatgaatgaccat
gaagacacaaatggttcaaaagaaagtttcagagaacaagatatatatcttccaattgca
aacgtagcaaggataatgaaaaacgccatacctcaaacgggaaagattgcaaaagatgcc
aaagaatgtgttcaggaatgtgtaagtgagttcatcagctttataacatctgaagcaagt
gaaagatgccatcaggagaaacggaagacaatcaacggagaagatattctctttgccatg
tctaccttaggcttcgacagttatgtagaacctctaaaattataccttcagaaattcaga
gaggctatgaaaggagagaaaggaattggtggagcagtcacaactacagatggattaagt
gaagaacttacagaggaggcatttactaaccagttaccagctggcttaataactgcagat
ggtcaacaacagaacgttatggtttatacaacgtcatatcaacagatttctggtgttcag
caaattcagttttcatga

KEGG   Felis catus (domestic cat): 101098871
Entry
101098871         CDS       T02385                                 
Symbol
NFYA
Name
(RefSeq) nuclear transcription factor Y subunit alpha isoform X6
  KO
K08064  nuclear transcription factor Y, alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05017  Spinocerebellar ataxia
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101098871 (NFYA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098871 (NFYA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101098871 (NFYA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101098871 (NFYA)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    101098871 (NFYA)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 101098871
NCBI-ProteinID: XP_003986175
Ensembl: ENSFCAG00000027813
UniProt: A0A2I2U126
LinkDB
Position
B2:42128022..42161868
AA seq 318 aa
MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQT
IMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQ
QQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGAN
TNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNA
KQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHM
QDPNQADEEAMTQIIRVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggagcagtatacagcaaacagcaatagttcgacagagcagattgttgtgcaggctgga
cagattcagcagcaggtccaggggcagccattaatggtacaggtcagtggaggccagtta
atcacatcaactggccaacccatcatggtccaagctgtccctggtggacaaggtcaaacc
atcatgcaagtacctgtgtctgggacacagggtttgcagcagatacagttggtcccacct
ggacagatccagatccagggcgggcaggctgtgcaggtgcagggccagcagggccagacc
cagcagatcatcatccagcagccccagacggcagtcactgctggccagacccagacccag
cagcagattgcggtccagggccagcaagtggctcagactgctgaagggcagaccatcgtc
tatcagccagttaatgcagatggcaccattctgcagcaagtcacagtccctgtttcaggc
atgatcaccatcccagcagccagtttggcaggagcacagattgttcagacaggagccaac
accaacaccaccagcagtggacaggggactgtcactgtgacactaccagtggcaggcaat
gtggtcaattcaggagggatggtcatgatggtgcctggtgctggctctgtgcctgctatc
caaagaatccctctccctggggcagagatgctggaagaagagcctctctatgtgaatgcc
aaacagtaccaccgtatactgaagaggaggcaagcccgggctaaactagaggctgaaggg
aaaattccaaaggaaagaaggaaatacctgcatgagtctcggcaccgtcacgccatggct
cggaagcggggtgaaggtggacggtttttctctccaaaggaaaaggatagtccccatatg
caggatccaaaccaagcagatgaagaagcaatgacacagatcatccgagtgtcctaa

KEGG   Felis catus (domestic cat): 101099313
Entry
101099313         CDS       T02385                                 
Symbol
NFYC
Name
(RefSeq) nuclear transcription factor Y subunit gamma isoform X3
  KO
K08066  nuclear transcription factor Y, gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101099313 (NFYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101099313 (NFYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101099313 (NFYC)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    101099313 (NFYC)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X E1-E2_ATPase
Other DBs
NCBI-GeneID: 101099313
NCBI-ProteinID: XP_019692322
Ensembl: ENSFCAG00000002915
UniProt: A0A337SS42
LinkDB
Position
C1:31802553..31869165
AA seq 439 aa
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPAAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSSTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATSAPQITQTEVQQGQQQFSQFTDGQRNSV
QPARGSELTGEAEPREVKATGNATPCTSSPPTTHTPSHRAGASCVCCAQPPQSPTPPPPS
DALQWVVVEVSGAPSQLEAHRELHAPLPGVTSLSPLHPSQQLYQIQQVTMPAGQDLAQPM
FIQSANQPSDGQAPQVTGD
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtccacagaaggaggatttggtggcactagcagcagtgatgcccagcaaagcctccag
tccttctggcctcgtgtcatggaagaaatccggaatttaacagtgaaagatttccgagta
caagaactcccactggctcgtattaagaagatcatgaaactggatgaagacgtgaagatg
atcagtgcagaagcccctgtgctctttgccaaggcagcccagatttttatcacagagttg
actcttcgagcctggatccacacggaggataacaagcgccggactctacagaggaatgat
atcgccatggcaattacaaaatttgatcagtttgactttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgtcaggaggaggtgcgccagtccgtgacccccgccgag
cccgtccagtactacttcacactggctcagcagcccgctgccgtgcaagtccaggggcag
cagcagggccagcagaccaccagctccacgaccaccatccagcctgggcagatcatcatc
gcgcagcctcagcagggccagaccacacctgtgaccatgcaggttggagaaggtcagcag
gtgcagattgtccaggctcagccgcagggtcaagcccagcaggcccagagcagcaccgga
cagaccatgcaggtgatgcagcagatcatcacaaacacaggagagatccagcagatcccg
gtgcagctgaatgccggccagctgcagtacattcgcttagcccagcctgtatcaggcacc
caagtcgtgcagggacagatccagacacttgccaccagcgctccacagatcacgcagaca
gaggtgcagcaaggacagcagcagttcagccagttcacggacggacagaggaacagcgtg
cagccagcccgaggctctgagctaacgggagaggcagagcccagagaagtgaaagccacg
ggaaatgcaactccctgcacctcttccccgcccaccacacacaccccctcacaccgggcc
ggagcctcctgtgtctgctgcgcccagcccccgcagagccccactccccctcctccctcc
gacgccttacagtgggtggtggtcgaggtgtccggggcccccagccaactcgaggcccat
agggagctgcatgcccctctcccgggggtgacctcactctctcctctccacccctcgcag
cagctctaccagatccagcaagtcaccatgcccgccggccaggacctcgcccagcccatg
ttcatccagtcagccaaccagccctccgacgggcaggccccccaggtgaccggcgactga

DBGET integrated database retrieval system