KEGG   Felis catus (domestic cat): 101083089
Entry
101083089         CDS       T02385                                 
Symbol
CFL2
Name
(RefSeq) cofilin-2
  KO
K05765  cofilin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05133  Pertussis
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101083089 (CFL2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101083089 (CFL2)
  09158 Development and regeneration
   04360 Axon guidance
    101083089 (CFL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101083089 (CFL2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101083089 (CFL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101083089 (CFL2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101083089 (CFL2)
   04147 Exosome [BR:fca04147]
    101083089 (CFL2)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Others
    101083089 (CFL2)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     101083089 (CFL2)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101083089 (CFL2)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 101083089
NCBI-ProteinID: XP_011281488
Ensembl: ENSFCAG00000008480
UniProt: M3W9N7
LinkDB
Position
B3:complement(86340755..86344993)
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
agaaaatcttctacacaagaggagatcaaaaaaagaaagaaagccgttctcttctgttta
agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt
ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc
cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta
tttatattctgggctcctgagagtgcacctttaaaaagcaagatgatttatgctagctct
aaagatgccattaaaaagaaatttacaggtattaaacatgaatggcaagtaaatggcttg
gatgatataaaggaccgttcaacacttggagagaaattgggaggcaacgtagtagtttca
cttgaaggaaaacccttataa

KEGG   Felis catus (domestic cat): 101100251
Entry
101100251         CDS       T02385                                 
Symbol
CFL1
Name
(RefSeq) cofilin-1 isoform X2
  KO
K05765  cofilin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05133  Pertussis
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101100251 (CFL1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101100251 (CFL1)
  09158 Development and regeneration
   04360 Axon guidance
    101100251 (CFL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101100251 (CFL1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101100251 (CFL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100251 (CFL1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101100251 (CFL1)
   04147 Exosome [BR:fca04147]
    101100251 (CFL1)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Others
    101100251 (CFL1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     101100251 (CFL1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101100251 (CFL1)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 101100251
NCBI-ProteinID: XP_003993693
Ensembl: ENSFCAG00000013272
UniProt: M3WIJ6
LinkDB
Position
D1:complement(110926502..110930088)
AA seq 166 aa
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcctctggtgtggcagtctctgatggtgtcatcaaagtgttcaatgacatgaaggtt
cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtactcttctgcctg
agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgatgtg
ggccagactgtagacgacccctacgccacctttgtcaagatgctgccagacaaggactgc
cgctatgccctctatgatgccacctacgagaccaaggagagcaagaaggaggacctggtg
tttatcttctgggcacctgaatgtgcacccctcaagagcaaaatgatttatgccagctcc
aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac
gaggaggtcaaggaccgctgcaccctggccgagaaactggggggcagcgccgtcatctcc
ctggagggcaagcctttgtga

DBGET integrated database retrieval system