KEGG   Felis catus (domestic cat): 101083959
Entry
101083959         CDS       T02385                                 
Name
(RefSeq) elongation factor 1-alpha, oocyte form-like
  KO
K03231  elongation factor 1-alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  Nucleocytoplasmic transport
fca05134  Legionellosis
fca05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    101083959
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101083959
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101083959
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101083959
   03016 Transfer RNA biogenesis [BR:fca03016]
    101083959
   03012 Translation factors [BR:fca03012]
    101083959
   04131 Membrane trafficking [BR:fca04131]
    101083959
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083959
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     101083959
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    101083959
Translation factors [BR:fca03012]
 Eukaryotic type
  Elongation factors
   101083959
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    101083959
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101083959
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Gtr1_RagA GTP_EFTU_D4 G-alpha
Other DBs
NCBI-GeneID: 101083959
NCBI-ProteinID: XP_003992670
Ensembl: ENSFCAG00000030530
LinkDB
Position
D1:42488196..42490835
AA seq 460 aa
MGKEKTHVNIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETNKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVAVNKMDSTEPTYSATRFQEITKEVSAYIKK
IGYNPATVAFVPISGWHGDNMLEPSGNMPWFKGWKVERKEGNATGVTLLEALDAILPPTR
PVNKPLRLPLQDVYKIGGIGTVPVGRVETGFLKPGMVVTFAPTNLTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGYVAGDSKNDPPMEAASFVAQVIILNHPGQIHAGYTPV
LDCHTVHVSCKFAELKEKIDRRSGKKLEDNPKALKSGDAAIVQMVPSKAMCVETFSEYPP
LGRFAVRDMRQTVAVGVIKAVDKKSSAGKVTKSAAKASKK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgggcaaagagaagacccatgtcaatattgttgtcatcggccacgtggactctggcaag
tccaccactaccgggcacctcatctacaagtgtgggggtatcgataagagaaccatcgag
aagttcgagaaggaggcagctgagatgggcaagggctccttcaaatatgcttgggtgctg
gacaagctgaaggcagagagagagcgtggcatcaccatcgacatctccctgtggaagttt
gagactaacaagttctacatcaccatcatcgatgccccaggccacagggacttcatcaag
aacatgataactggcacatcccaggccgactgcgccgtgctcatcgtggcgggcggcgtg
ggcgagtttgaagctggcatctccaaaaacgggcagacccgcgagcacgcgctgctggcc
tacacgctgggcgtgaagcagctcatcgtggcggtcaacaagatggactccaccgagccc
acctacagcgccacacgcttccaggagatcaccaaggaagtgagcgcctacatcaagaag
atcggctacaacccggccaccgtggccttcgtgcccatctccggctggcacggcgacaac
atgctggagcccagcggcaacatgccctggttcaagggctggaaggtggaacggaaggag
ggaaatgccaccggggtgactctgctggaagctctggatgccatcctcccgcccactcgc
ccagtcaacaagcccctgaggctccctctgcaggacgtgtacaagattggaggcattggc
actgtgcctgtgggccgtgtagagaccggcttcctgaaacctgggatggtggtcaccttt
gcccccacaaacctcaccacagaggtcaagtctgtggagatgcatcatgaggccctgtct
gaggccctgcccggtgacaacgtgggcttcaacgtgaagaatgtgtccgtaaaggacata
cgccgtggatatgtggctggagacagcaaaaatgacccccccatggaggccgccagcttt
gtggcacaggtgattatcttgaatcaccccgggcagatccatgctggctataccccagtg
ctggactgccatacagttcacgtctcctgcaagtttgccgaactgaaggaaaagattgac
cggcgctcaggcaagaagctcgaggacaaccccaaggccctgaagtcgggtgacgcagcc
attgttcagatggtccccagcaaggctatgtgcgtggagaccttctcagagtacccacct
ctaggccgttttgccgtgcgggacatgagacaaacagtggccgtgggagttattaaggct
gtggataagaagtcatctgctggcaaggtcaccaagtcagcggcaaaggccagcaagaag
tga

KEGG   Felis catus (domestic cat): 101100798
Entry
101100798         CDS       T02385                                 
Symbol
EEF1A2
Name
(RefSeq) elongation factor 1-alpha 2
  KO
K03231  elongation factor 1-alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  Nucleocytoplasmic transport
fca05134  Legionellosis
fca05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    101100798 (EEF1A2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101100798 (EEF1A2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101100798 (EEF1A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101100798 (EEF1A2)
   03016 Transfer RNA biogenesis [BR:fca03016]
    101100798 (EEF1A2)
   03012 Translation factors [BR:fca03012]
    101100798 (EEF1A2)
   04131 Membrane trafficking [BR:fca04131]
    101100798 (EEF1A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100798 (EEF1A2)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     101100798 (EEF1A2)
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    101100798 (EEF1A2)
Translation factors [BR:fca03012]
 Eukaryotic type
  Elongation factors
   101100798 (EEF1A2)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    101100798 (EEF1A2)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101100798 (EEF1A2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Other DBs
NCBI-GeneID: 101100798
NCBI-ProteinID: XP_023106736
Ensembl: ENSFCAG00000028726
LinkDB
Position
A3:973829..983117
AA seq 463 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKALKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggcaaggagaagacccacatcaacatcgtggtcataggccacgtggactccggcaag
tccaccacgacaggccacctcatctacaagtgcggaggcatcgacaagaggaccatcgag
aagtttgagaaggaggcggcggagatggggaagggctccttcaagtacgcctgggtgctg
gacaaactgaaggcggagcgggagcgcggcatcaccatcgacatctccctctggaagttc
gagaccaccaagtactacatcaccatcatcgatgcccccggccaccgcgacttcatcaag
aacatgatcactggcacgtcccaggcggactgcgcggtgctcatagtggctgcaggagtg
ggcgagttcgaggcgggcatctccaagaacgggcagacccgtgagcacgcgctgctggcc
tacacgctgggcgtgaagcagctcatcgtgggggtcaacaagatggactccacggagccc
gcctacagcgagaagcgctacgacgagattgtcaaggaggtcagcgcctacatcaagaag
atcggctacaaccccgccactgtgcccttcgtgcccatctccggctggcacggcgacaac
atgctggagccctcccccaacatgccgtggttcaagggctggaaagtggagcgtaaggag
gggaacgccagcggcgtgtccctgctggaggccctggacaccatcctgccccctacacgc
cccacagataagcccctgcgcctgccactgcaggacgtgtacaagatcggcggcattggc
accgtgcccgtgggccgagtggagacgggcatccttcggccgggcatggtggtgaccttt
gcacccgtcaacatcaccacggaggtgaagtcagtggaaatgcaccatgaggccctgagc
gaggccctgcctggcgacaacgtcggcttcaacgtgaagaacgtgtcggtcaaggacatc
cgccgaggcaacgtgtgtggggacagcaagtccgacccaccccaggaggctgcccagttc
acctcccaggttatcatcctgaaccacccagggcagatcagtgccggctactcaccggtc
atcgactgccacacggcacacatcgcctgcaagtttgcggagctgaaggagaagattgac
cggcgctcaggcaagaagctggaggacaaccccaaagccctgaagtccggtgacgcagcc
atcgtggagatggtccctgggaagcccatgtgtgtggagagcttctcacagtacccacct
ctcggccgcttcgccgtgcgcgacatgcggcagacggtggccgtgggcgtcatcaagaac
gtggaaaagaagagcggcggcgccggcaaggtcaccaagtccgcgcagaaggctcagaag
gcgggcaagtga

KEGG   Felis catus (domestic cat): 109502152
Entry
109502152         CDS       T02385                                 
Name
(RefSeq) elongation factor 1-alpha, somatic form-like
  KO
K03231  elongation factor 1-alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  Nucleocytoplasmic transport
fca05134  Legionellosis
fca05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    109502152
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109502152
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109502152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    109502152
   03016 Transfer RNA biogenesis [BR:fca03016]
    109502152
   03012 Translation factors [BR:fca03012]
    109502152
   04131 Membrane trafficking [BR:fca04131]
    109502152
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    109502152
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     109502152
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    109502152
Translation factors [BR:fca03012]
 Eukaryotic type
  Elongation factors
   109502152
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    109502152
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   109502152
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Gtr1_RagA GTP_EFTU_D4 G-alpha
Other DBs
NCBI-GeneID: 109502152
NCBI-ProteinID: XP_023114068
LinkDB
Position
C1:17654393..17664841
AA seq 424 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIDRFEKEAAEVGKGSFKYAWVL
DKLKAERERGITIDISLWKFETKKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVASGV
GEFESGISKNGQTREHVLLAYTLGVKQLIVAVNKMDITEPPYSSARFEEISKEVKAYIKK
IGYNSEAVAFVPISGWHGDNMIEPSNKMSWFRGWKITRKEGNMVGMTLLEALDSIMPPAR
PVNKPLRLPLQDVYKIGGIGTVPVGRVETGFLRPGMVVTFAPCNITTEVKSVEMHHEALA
EALPGDNVGFNVKNVSVKDIRRGYVAGDSKNDPPSEVGSFISQVIILNHPGSIAAGYSPV
LDCHTAHIACKFAELREKIDRRSGKKLEDNPKALKSGDSAIVQMIPRKPMCVESFSEYPP
LGKS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggcaaagagaagacccacatcaacattgtggtcatcggccacgtggattcgggcaag
tccaccacaacggggcatctcatctacaaatgtgggggcatcgacaagaggaccatcgac
aggtttgagaaggaggccgcggaggtgggcaaaggttccttcaagtacgcctgggtactg
gacaagctgaaggcagagcgggaacgtggcatcaccattgacatctccctgtggaagttt
gagaccaaaaaatactacatcaccatcatcgatgccccaggtcaccgtgacttcatcaag
aacatgatcacaggcacctcacaggcagactgcgctgtgctgattgtggcaagtggcgta
ggtgagtttgagtctggcatctctaagaatgggcagacccgtgagcatgtactgctggcc
tatacgctgggtgtgaagcagctcatcgtggcggtcaataagatggacatcacggagcct
ccttacagtagtgcacgctttgaggagatcagcaaggaggtgaaggcctatatcaagaag
atcggttacaactctgaggctgttgcctttgtgcccatctccggctggcatggagacaac
atgatagaacccagcaacaagatgtcctggttcagaggctggaagatcaccaggaaggaa
ggaaacatggtaggcatgaccctgctagaagcactagactccatcatgccccctgctcgc
cctgtgaacaagcccctgcggctgcctctgcaggacgtatataagattgggggcatcggc
actgtgcccgtgggccgggtagaaacaggcttcctcaggcccggcatggtggtgaccttt
gccccctgcaatatcaccacggaggtcaagtctgtagagatgcaccacgaggccctggct
gaggccctgcccggcgacaatgtgggcttcaatgtgaagaacgtgtcggtgaaggacatc
aggcggggctatgtggcaggagacagcaagaatgacccaccctcagaggtggggagcttc
atctcccaggtgatcattctcaaccaccctggcagtattgcggctggctactcaccagtt
ctggactgccacacggcccacatcgcctgtaagtttgcagagctcagggagaagatcgac
cggcgctcaggcaagaagctggaagataatcccaaagccctaaagtctggggactcggcc
attgttcagatgatcccacgaaagcccatgtgtgtagaaagcttctcagagtacccaccc
cttggtaagtcctga

KEGG   Felis catus (domestic cat): 493922
Entry
493922            CDS       T02385                                 
Symbol
EEF1A1
Name
(RefSeq) elongation factor 1-alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  Nucleocytoplasmic transport
fca05134  Legionellosis
fca05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    493922 (EEF1A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    493922 (EEF1A1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    493922 (EEF1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    493922 (EEF1A1)
   03016 Transfer RNA biogenesis [BR:fca03016]
    493922 (EEF1A1)
   03012 Translation factors [BR:fca03012]
    493922 (EEF1A1)
   04131 Membrane trafficking [BR:fca04131]
    493922 (EEF1A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    493922 (EEF1A1)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     493922 (EEF1A1)
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    493922 (EEF1A1)
Translation factors [BR:fca03012]
 Eukaryotic type
  Elongation factors
   493922 (EEF1A1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    493922 (EEF1A1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   493922 (EEF1A1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 493922
NCBI-ProteinID: NP_001009326
Ensembl: ENSFCAG00000030977
UniProt: Q66RN5
LinkDB
Position
B2:complement(69172513..69177417)
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggagaagactcatatcaacatcgtcgtcattggacacgtagattcgggcaag
tctaccactactggtcatctgatctacaaatgtggtgggatcgacaaaagaactatcgaa
aaatttgagaaggaggctgctgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagcagaacgtgaacgtggtatcaccattgatatctccctgtggaaattc
gagaccagcaagtactatgtgaccatcattgatgccccaggacacagagactttatcaaa
aatatgattacgggcacatctcaggctgactgtgcggtcctgattgttgctgctggtgtt
ggcgaatttgaagcaggtatctccaagaatgggcagacccgtgagcatgcccttctggct
tacacactgggtgtaaaacaacttattgtcggtgttaacaaaatggattccactgagcca
ccctacagccagaagagatacgaggaaatcgttaaggaagtcagcacctacattaagaaa
attggctacaaccccgacaccgtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaatatgccttggttcaagggatggaaagtcacccgtaaagat
ggcaatgccagtggaaccacactgcttgaagctctggattgcattctgccacctactcgt
ccaactgacaagcccttgcgtctgcccctccaggatgtctacaaaattggtggtattggt
actgtccctgtgggtcgagtggagaccggtgttcttaagccaggcatggtggtcactttt
gctccagtcaatgttacaactgaagtaaagtccgttgaaatgcaccatgaagctttgagt
gaggctctacctggggacaacgtgggcttcaatgtcaagaacgtatctgtcaaagatgtt
cgtcgtggcaatgtggctggtgatagcaaaaatgacccaccaatggaagcagctggcttc
acagctcaggtgattatcctgaaccatccaggccaaatcagtgccggatatgcacctgtg
ctggactgtcacacagctcacatcgcctgcaagtttgctgagctgaaggagaagattgac
cgtcgttctggaaaaaagctggaagatggtcccaagttcttaaaatctggtgatgctgcc
atcgttgatatggttcctggcaagcccatgtgtgttgagagcttctctgactatcctcct
ctgggccgttttgctgttcgtgacatgagacagacggttgctgtgggtgtcatcaaagca
gtggacaagaaggcagctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

DBGET integrated database retrieval system