KEGG   Felis catus (domestic cat): 101083973
Entry
101083973         CDS       T02385                                 
Symbol
NCOR2
Name
(RefSeq) nuclear receptor corepressor 2 isoform X1
  KO
K06065  nuclear receptor co-repressor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101083973 (NCOR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101083973 (NCOR2)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 101083973
NCBI-ProteinID: XP_023097058
LinkDB
Position
D3:5681331..5863567
AA seq 2602 aa
MSGSTQPVAQTWRATEPRYPPHGISYPVQIARPHTDVGLLEYQHHPRDYASHLSPGSILQ
PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
SPLLAAGQPGGSEDPSKDRSLAGKLEPVSPPSPPHADPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLRKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIESNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPM
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQMPRSNQEEKDEKEKDKEAEKEEEKPDVENDKEE
LTKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAVTPQQSAEL
ASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDE
ILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPAVEDDEMEVSGGSGNEEDVAEEAEAL
HASGNEVPRGECSGPATVNNSSDTESIPSPRAEAAKDAGQNGPKPPPAPGADVPAPEPPT
PPPEDALAPAEPAPAPEAAGPPTPPPAPPSPTAPPPVVPKEEKEEEVATAPLVAEEEEQK
PPVAQELSVDVRKPEEPAEAPPTEPIKSECKEEAPEDGPHKGKGGPEASVEAAPEGALKV
EKKEGGGPGGKAPTTKGAGAPQDSDSSATCSADEVDEPEGGDKNRLLSPRPSLLTPSSDT
RANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPPAPPPPQHLQPENDTPQQPG
NSPRGKSRSPVPPAEKEAEKPVFFSAFAADGQKLPTEPPCWTSGLPFPVPPREVIKASPH
APDPSAFSYAPPGHPLPLGLHDSARPVLPRPPTISNPPPLISSAKHPSVLERQMNAISQG
MSVQLHVPYSEHAKAPVGPITMGLPLAMDPKKLAPFSGVKQEQLSPRGQAGPPENLGVPT
AQETSVLRGTSLGSVPGGSITKGIPGTRVPSESPITYRGSITHGTPADVLYKGTITRIIG
EDSPSRLDRSREDSLPKGHVIYEGKKGHVLSYEGGISVSQCSKEDGRSSSGPPHETAAPK
RTYDMMEGRVSRAISSAGIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQE
DYLRREAKLLKREGTPPPPPPPRDLAEAYKARPLEALGPLKLKPAHEGLVATVKEAGRSI
HEIPREELRRTPELPLAPRPLKEGSITQGTPLKYDTGPSSAGSKKHDVRSIIGSPGRTFP
PVHPLDVMADARALERACYEESLKGRPGAAGSSGGSITRGAPVIVPELGKPRQSPLAYEE
HGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSAMPEHHP
HPISPYEHLLRGVSGVDLYRGHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLY
PPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYA
AGPRGIIDLSQVPHLPVLVPPTPGTPAAAAMDRLAYLPTAPQHFSSRLSSSPLSPGGPTH
LTKPATTSSSERERERDRERDRERDREREKPVLTSATTVEHAPIWRPGTEQSSGGSGGGG
GGGGSGSGRPTPHSHQHSPMSPRAQDTVQQRPSVLHNTGMKGILTSVEPSTPTVLRWARS
TSASSPVRPAATFPPTTHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADAGHAFL
AKPPARSGLEPASSPSKGSEPRPLAPPGSSHTAIARTPAKSLAPHHASPDQPAPPASAAD
PHREKTQSKPFSIQELELRSLGKTTLTAATFIDAIIMRQIAHDKGPREGGSLANDSPRDG
YHGGSYSPDGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGDLRHKQPGPGKLSGEAAH
LPHLRPLPESQPSSSPLLQTTPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLNAPLPAP
LYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRHHVLTGMLTTTPGSVGG
IVPMSPVKELRSPEPSKTSALGSSEDAIEPVSPPEGMAEPGHPRSAMYPLLYRDGDQAEP
SRMGSKSPGNSSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNIGQPGTEIF
NMPAITGAGLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPLSANAFNPLNASA
SLPAAMPITAADGRSEHALTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHS
EGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPH
HAWDEEPKPLLCSQYETLSDSE
NT seq 7809 nt   +upstreamnt  +downstreamnt
atgtcggggtccacgcagcctgtggcgcagacgtggagggccaccgagccccgctacccg
ccccatggcatttcttaccctgtgcagatcgcccggccccacacggacgtcgggctgctc
gagtaccagcaccacccccgtgactacgcctcgcacctgtcgcccggttccatcctccag
ccccagaggaggaggccctccctgctgtccgaatttcagcctgggaacgagaggtcccag
gagctccacctgcgacccgagtcccactcctacctgcccgagctgggcaagtcagagatg
gagttcatcgagagcaagcgccctcgcctggagctgctgccggatcccctgctgcggccc
tcacccctgctggctgcgggccagcctgggggctcggaggacccgtccaaggaccgcagc
ctggcgggcaagctggagcccgtgtctccccccagcccgccgcacgccgaccccgagttg
gagcttgtacctccgcggctctccaaggaggagctgatccagaacatggaccgggtggac
cgcgagatcaccatggtggagcagcagatctccaagctgaggaagaagcagcaacagctg
gaggaggaggccgccaagcccccggagcccgagaagcccgtgtcgccgccgcccatcgag
tcgaagcatcgcagcctggtgcagatcatctacgacgagaaccggaagaaggctgaagcc
gcccatcggattctggaaggcctggggcctcaggtggagctgcccctgtacaaccagccg
tccgacaccaggcagtatcatgagaacatcaaaataaaccaggcgatgcggaaaaagtta
atcttgtacttcaagaggaggaaccacgctcggaaacaatgggagcagaagttctgccag
cgctatgaccagctcatggaggcctgggagaagaaggtggagcgcatcgagagcaacccc
cggcggcgggccaaggagagcaaggtgcgcgagtactacgagaagcagttccccgagatc
cgtaagcagcgcgagctgcaggagcgcatgcagagcagggtgggccagcggggcagcggg
ctttccatgtcggccgcccgcagcgagcacgaggtgtccgagatcatcgatggcctctcc
gagcaggagaacctggagaagcagatgcgccagctggccgtgatcccgccgatgctctac
gacgctgaccagcagcgcatcaagttcatcaacatgaacgggctcatggacgaccccatg
aaggtgtacaaggaccgccaggtcatgaacatgtggagcgagcaggagaaggagaccttc
cgggagaagttcatgcagcaccccaagaacttcggcctgatcgcatcgttcctggagagg
aagaccgtggccgagtgtgtcctctattactacctgaccaagaagaacgagaactacaag
agcctggtgaggaggagctaccggcgccgcggcaagagccagcagcagcagcagcagcag
cagcagcagcagcagcagcaaatgccccggagcaaccaggaggagaaggatgagaaggag
aaggacaaggaggctgagaaggaagaggagaagcccgacgtggagaacgacaaggaggag
ctgaccaaggagaagacggacgacacctctggggaggacaacgatgagaaggaggcagtg
gcctctaaaggccggaaaactgccaacagccaggggagacgcaaaggccgcatcacccgc
tccatggccaacgaggccaacagtgaggaggccgtcaccccacagcagagcgccgagctg
gcttcgatggagatgaacgagagctctcgctggacggaggaggagatggagaccgccaag
aaaggtcttctggaacacggccggaactggtcggccatcgcacggatggtgggctccaag
accgtgtctcagtgtaagaacttctacttcaactacaagaagaggcagaacctggacgag
atcctgcagcagcacaagctgaagatggagaaggagaggaatgcgcggaggaagaagaag
aaagccccggctgccgccagtgaggaggccgccttcccgcccgcggtggaggatgatgag
atggaggtgtcaggagggagcgggaacgaagaggacgtggcagaggaggcggaagcctta
cacgcctctgggaacgaggtgcccagaggggaatgcagtggcccagccaccgtcaacaac
agttctgacaccgagagcatcccctccccccgcgccgaggccgccaaggacgcggggcag
aacgggcccaagcccccgcctgccccaggcgccgacgtgccagcccctgagccgcccaca
ccaccgccggaggatgcgctggcccccgccgagcccgccccggcccccgaagccgccggc
ccgcccacgcccccaccggcacccccatcgcccaccgcaccccctcctgtggtccccaag
gaggagaaggaagaagaggttgccacggcccccctggtggcagaggaggaggagcagaag
ccccccgtggcccaggagctgtccgtggacgtgcgcaagccagaagagcctgccgaggca
ccccccacagagcccatcaagagcgaatgcaaagaggaggccccggaggacgggccccac
aagggcaaaggaggccctgaggccagcgtggaggccgcccccgagggggccctcaaggtg
gagaagaaagagggcggcggccctgggggcaaagcccccacgaccaagggagcaggggcc
ccccaggacagcgactccagcgccacctgcagtgcggacgaggtggatgagcccgagggc
ggcgacaagaacaggctgctgtcaccacggcccagcctcctcaccccgagcagtgacacc
agggccaacgcctccccccagaagccgctggacctgaagcagctgaagcagcgggcggcc
gccatacccccgatccaggtcaccaaagtccatgagcccccccgggaggacgcggctccc
cctgcccccccgccgccacagcacctgcagccggagaacgacaccccccagcagcccggc
aacagcccccgaggcaaaagcaggagccccgtgcctcctgctgagaaggaggcagagaag
cctgtgttcttctcggcctttgcagctgacggccagaagctgcccacagagcctccgtgc
tggacgtcgggcctgcccttccctgtgccccctcgtgaggtgatcaaggcctccccgcac
gcccctgacccctcggccttctcctacgccccgcctggtcacccactgcccctgggcctc
catgacagcgcccggcccgtcctgcctcgcccacccaccatctccaacccgccgcccctc
atctcctccgctaagcaccctagcgtcctcgagaggcaaatgaacgccatctcccaggga
atgtcggtgcagctccacgtcccttactcagagcacgccaaggcccctgtgggccccatc
accatggggctgccccttgccatggaccccaagaagctggcgcccttcagcggagtgaag
caggagcagctgtccccgcggggccaggctgggcccccggagaacctgggggtgcccaca
gcccaggagacatctgtgctgagagggacgtctctgggctcggttccgggaggaagcatc
accaagggcatccccggcacgcgggtgccttctgagagccccatcacgtaccgtggctcc
atcacccacggcaccccggccgacgtcctgtacaaaggcaccatcaccaggatcatcggc
gaggacagcccgagtcgtctggaccgcagccgggaggacagcctgcctaagggccacgtc
atctacgagggcaagaagggccacgtcctgtcctacgagggtggcatatctgtgtcccag
tgctccaaggaggacggcaggagcagctccggacccccgcatgagacggccgcccccaag
cgcacctacgacatgatggagggccgcgtcagcagggccatctcctctgccggcatcgaa
ggtctcatgggccgggccatcccgccggagcgacacagcccccaccacctcaaggagcag
caccacatccgaggctccatcacacaagggatcccgcggtcctacgtggaggcccaggaa
gactacctccgtcgggaggccaagctcctgaaacgcgagggcacgccgccaccgcccccg
cccccacgggacctggccgaggcctacaaggcccggcccctggaggcgctgggccccctg
aagctgaagccggcccacgaggggctggtggcgacggtgaaggaggccggccgctccatc
cacgagattccccgggaagagttgcggcgcacgcccgagctgcccctggccccgcggccg
ctcaaggagggctccatcacgcagggcaccccgctcaagtatgacactggcccgtcctcc
gccggctccaaaaagcatgacgtgcgctccatcatcggcagccccggccgcacgttcccg
cccgtgcacccgctggacgtgatggccgacgcccgggcgctggagcgcgcctgctacgaa
gagagcctgaagggccggccgggggcagccggcagctcggggggctccatcacccggggg
gccccggtcatcgtgcctgagctgggcaagccgcgccaaagccccctggcctacgaggag
cacggggcgcccttcgccggccacctcccacgcggctcgccggtgaccacacgggagccc
accccacgcctgcaagagggcagcctctcatctagcaaggcatcccaggaccggaagctg
acgtccacgccccgggagatcgccaagtccccccacagcgccatgcctgagcaccacccc
caccccatctcgccctacgaacacctgcttcggggcgtgagcggtgtggacctgtaccgc
ggccacatccccctggccttcgatcccacctccataccccgcgggatccctctcgatgca
gccgcggcctattacctgccccgacacctggcccccaaccccacctacccgcatctgtac
ccgccttacctcatccgcggctaccccgacacggcggcgctggagaaccgccagacaatc
atcaacgactacatcacctcgcagcagatgcaccacaacgcggcgaccgccatggcccag
cgggccgacatgctgaggggcctctcgccccgcgaatcctctctggcactcaactatgcc
gctggccctcgaggcatcatcgacctgtcccaagtgccacacctccccgtgctggtgccc
ccgaccccgggcacaccggccgccgccgccatggaccgccttgcctacctccccacagcg
ccccagcacttcagcagccggctcagcagctccccgctctccccagggggtcccactcac
ttgacgaaacccgccaccacctcgtcatccgagagggagcgggagcgtgaccgggagcgc
gaccgggagcgtgaccgggagcgcgagaagccggtcctcacgtccgccaccaccgtggag
cacgcgcccatctggagacctggtacggagcagagcagcggcggcagcggcggcggaggg
ggtgggggcggcagcggcagcggccgccccaccccccactcccaccagcactcgcccatg
tcaccccgggcccaggacaccgtccagcagagacccagcgtgctgcacaacacgggcatg
aagggcatcctcacctccgtggagcccagcacgcccacggtcctgaggtgggccaggtcc
acctctgcctcctcgcctgtccgcccggccgccacattcccacccaccacccactgtcct
ctgggtggcaccctggacggggtctaccccaccctcatggagcctgtcttgctgcccaag
gaggccccaagggtcgcccggcccgagcggccccgtgcggacgctggccacgccttcctt
gccaagcccccagcccgctctgggctggagcccgcctcctcccccagcaaaggctccgag
ccgcggcccctggcgccccccggctccagccacacggccatcgcccgcaccccagcaaag
agcctcgcaccccaccacgccagcccggaccagcctgcgccgcccgcctcggccgcggac
ccgcaccgggaaaagactcaaagtaaacccttttccatccaggaattggagctccgttct
ctgggtaagaccaccctgacagcggccaccttcatagacgcgataatcatgcgtcaaatt
gctcacgataaagggccgcgagaaggaggttcgctggccaacgactcccctcgcgatggt
taccacggcggcagctacagccccgacggggtggagcccgtcagccccgtgagctcgccc
agcctgacccatgacaaggggctccccaagcacctcgaggagctcgacaagagccacctg
gagggggacctgcggcacaagcagccaggccccggaaagctcagcggtgaggccgcgcac
ctcccacacctgcggccgctgcccgagagccagccctcgtccagcccgctgctccagacc
acccccggggtcaaaggtcaccagagggtggtcaccctggcacagcacatcagcgaggtc
atcacacaggattacacacggcaccacccgcagcagctcaacgcacccctcccggccccc
ctctactccttccctggagccagctgcccggtcctggacctgcgccgcccccccagtgac
ctctacctcccgcccccggaccatggcgccccggctcgcggctcaccccacagtgaaggg
ggcaagaggcaccatgtgttaaccgggatgctcaccacaaccccaggaagtgtaggcggt
attgtccccatgtcaccggtgaaagaactgaggtctccagagcccagcaagacgtccgcc
ctgggcagcagtgaggatgccatcgagcccgtgtccccacccgagggcatggcagagcct
gggcatccccgaagcgccatgtacccgctgctgtaccgggacggggaccaggcagagccc
agcagaatgggctctaaatctccaggcaacagcagccagccgccggccttcttcagcaaa
ctgaccgagagcaactccgccatggtcaagtcgaagaagcaggagatcaacaagaagctg
aacacccacaaccggaacgagccagaatacaatatcggccagcccgggacggagatcttc
aacatgcccgccatcaccggagcaggccttatgacctgcagaagccaggcggtgcaggaa
catgccagcaccaacatggggctggaggccattattagaaaggcgctcatgggtaaatat
gatcagtgggaggagcccccgctcagcgccaacgcttttaaccctctgaatgccagtgcc
agcctgcccgctgctatgcccataaccgctgctgacggacggagcgaacacgcactcacc
tcgccaggtggtggcgggaaggccaaagtctctggcagacccagcagccgcaaagccaag
tccccggccccgggcctggcgtccggggaccggccgccctccgtctcctcggtgcactcg
gagggggactgcaaccgccggaccccactcaccaaccgcgtgtgggaggaccggccctcg
tccgcaggttccacaccgtttccctacaaccccctgatcatgcggctgcaggcgggtgtc
atggcctccccacccccgcctggcctccccgcgggcagcgggccccttgccggtccccac
cacgcctgggacgaggagcccaagccgctgctctgctcacagtacgagacgctctccgac
agcgagtga

DBGET integrated database retrieval system