KEGG   Felis catus (domestic cat): 101084186
Entry
101084186         CDS       T02385                                 
Symbol
CSNK2A1
Name
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03008  Ribosome biogenesis in eukaryotes
fca04064  NF-kappa B signaling pathway
fca04137  Mitophagy - animal
fca04310  Wnt signaling pathway
fca04520  Adherens junction
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05162  Measles
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101084186 (CSNK2A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101084186 (CSNK2A1)
   04064 NF-kappa B signaling pathway
    101084186 (CSNK2A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101084186 (CSNK2A1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101084186 (CSNK2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101084186 (CSNK2A1)
  09172 Infectious disease: viral
   05162 Measles
    101084186 (CSNK2A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084186 (CSNK2A1)
   05020 Prion disease
    101084186 (CSNK2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    101084186 (CSNK2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101084186 (CSNK2A1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fca03009]
    101084186 (CSNK2A1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101084186 (CSNK2A1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  CK2 family
   101084186 (CSNK2A1)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic type
  90S particles
   Kinase
    101084186 (CSNK2A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal Kdo Choline_kinase DUF5898 FTA2
Other DBs
NCBI-GeneID: 101084186
NCBI-ProteinID: XP_003983723
Ensembl: ENSFCAG00000003280
UniProt: A0A337SK77
LinkDB
Position
A3:complement(27973949..28027720)
AA seq 391 aa
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaatacgcacagaccc
cgagagtactgggattatgagtcacatgtggtggagtggggtaatcaagatgactaccaa
ctcgttcgaaaattaggccggggtaaatacagtgaagtatttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaagaagaagaaaatcaagcgt
gaaataaagattttggagaatttacgaggcggtcccaatatcatcacactggcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacacgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgatattcgattttacatgtatgagatt
ctgaaggccctggattattgtcacagcatgggaattatgcacagagatgtgaagccccat
aatgtcatgattgatcacgagcacagaaagctacgactaatagactggggtttggctgag
ttttaccatcctggccaagaatacaatgtcagagttgcttcccgatacttcaaaggtcct
gagctacttgtagactatcagatgtatgattatagtttggatatgtggagcttgggttgt
atgctggcaagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctggggacagaagatttatatgactatattgacaaa
tacaacattgaattagatccacgtttcaatgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcaccttgtcagccccgaggccttggatttc
ttggacaagctgctgcgatatgaccaccagtcacggcttaccgcaagagaggccatggag
cacccctatttctatactgttgtgaaggaccaggctcgaatgggctcatctagcatgccg
gggggcagtacgcctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaacc
ccttcaccccttggacctctggcaggctcaccagtgattgctgctgccaacccccttggg
atgcctgttccagctgccgctggcgctcagcagtaa

KEGG   Felis catus (domestic cat): 101087664
Entry
101087664         CDS       T02385                                 
Symbol
CSNK2B
Name
(RefSeq) casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca03008  Ribosome biogenesis in eukaryotes
fca04064  NF-kappa B signaling pathway
fca04137  Mitophagy - animal
fca04310  Wnt signaling pathway
fca04520  Adherens junction
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05162  Measles
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101087664 (CSNK2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101087664 (CSNK2B)
   04064 NF-kappa B signaling pathway
    101087664 (CSNK2B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101087664 (CSNK2B)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101087664 (CSNK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101087664 (CSNK2B)
  09172 Infectious disease: viral
   05162 Measles
    101087664 (CSNK2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087664 (CSNK2B)
   05020 Prion disease
    101087664 (CSNK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    101087664 (CSNK2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fca03009]
    101087664 (CSNK2B)
   03036 Chromosome and associated proteins [BR:fca03036]
    101087664 (CSNK2B)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic type
  90S particles
   Kinase
    101087664 (CSNK2B)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     101087664 (CSNK2B)
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 101087664
NCBI-ProteinID: XP_003985976
Ensembl: ENSFCAG00000007642
LinkDB
Position
B2:32660946..32665020
AA seq 215 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaattcaacctcactggactcaat
gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggctactgtccccgtgtgtactgtgagaatcagccaatgctt
cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc
atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc
accggtttccctcacatgctcttcatggtgcaccctgagtaccggcccaaacggcccgcc
aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

KEGG   Felis catus (domestic cat): 101093065
Entry
101093065         CDS       T02385                                 
Symbol
CSNK2A2
Name
(RefSeq) casein kinase II subunit alpha' isoform X1
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03008  Ribosome biogenesis in eukaryotes
fca04064  NF-kappa B signaling pathway
fca04137  Mitophagy - animal
fca04310  Wnt signaling pathway
fca04520  Adherens junction
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05162  Measles
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101093065 (CSNK2A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101093065 (CSNK2A2)
   04064 NF-kappa B signaling pathway
    101093065 (CSNK2A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101093065 (CSNK2A2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101093065 (CSNK2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093065 (CSNK2A2)
  09172 Infectious disease: viral
   05162 Measles
    101093065 (CSNK2A2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093065 (CSNK2A2)
   05020 Prion disease
    101093065 (CSNK2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    101093065 (CSNK2A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101093065 (CSNK2A2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fca03009]
    101093065 (CSNK2A2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101093065 (CSNK2A2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  CK2 family
   101093065 (CSNK2A2)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic type
  90S particles
   Kinase
    101093065 (CSNK2A2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal DUF5898 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 101093065
NCBI-ProteinID: XP_023101406
Ensembl: ENSFCAG00000030709
LinkDB
Position
E2:complement(37117338..37155835)
AA seq 350 aa
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNY
DQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagcagggcccgggtctacgccgaggtgaacagcctgagg
agccgcgagtactgggactatgaggctcacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggaaagtatagtgaagtatttgaggccattaacatc
accaacaatgagagagtggttgtaaaaattctcaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaatcttcgtggtggaacaaatatcattaagctgattgac
actgtgaaggaccctgtgtcaaagacgccggctttggtatttgaatatatcaataataca
gattttaagcaactataccagatcctgacagactttgatatccggttttatatgtatgag
ctgcttaaggctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaacgtcatgatagatcatcaacagaaaaagctgcgactgatagactggggcctggca
gagttctaccaccctgctcaggagtacaatgtccgtgtagcctcgaggtacttcaagggc
cctgagctcctcgtggactatcagatgtatgattacagcttggacatgtggagtttgggc
tgtatgttagcaagcatgatctttcgaaaggagcccttcttccatggacaggacaactac
gaccagcttgttcgcattgccaaggttctgggtacagatgagctgtatggctatctgaag
aagtatcacatagacctagatccgcacttcaacgatatcctgggacaacattcacggaaa
cgctgggaaaactttatccatagtgagaacagacatctcgtcagccccgaggccctagat
cttctggacaaacttctgcgatacgaccatcagcagagactgactgccaaagaggccatg
gagcacccgtacttctaccccgtggtgaaggagcagtcccaaccttgtgcagacaacgct
gtgctttccagtggcctcacggcagcccggtga

DBGET integrated database retrieval system