KEGG   Felis catus (domestic cat): 101084342
Entry
101084342         CDS       T02385                                 
Symbol
CAMK2A
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04114  Oocyte meiosis
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101084342 (CAMK2A)
   04310 Wnt signaling pathway
    101084342 (CAMK2A)
   04066 HIF-1 signaling pathway
    101084342 (CAMK2A)
   04020 Calcium signaling pathway
    101084342 (CAMK2A)
   04024 cAMP signaling pathway
    101084342 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101084342 (CAMK2A)
   04217 Necroptosis
    101084342 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101084342 (CAMK2A)
   04922 Glucagon signaling pathway
    101084342 (CAMK2A)
   04912 GnRH signaling pathway
    101084342 (CAMK2A)
   04921 Oxytocin signaling pathway
    101084342 (CAMK2A)
   04916 Melanogenesis
    101084342 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    101084342 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101084342 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    101084342 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    101084342 (CAMK2A)
   04728 Dopaminergic synapse
    101084342 (CAMK2A)
   04720 Long-term potentiation
    101084342 (CAMK2A)
   04722 Neurotrophin signaling pathway
    101084342 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    101084342 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    101084342 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    101084342 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101084342 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084342 (CAMK2A)
   05205 Proteoglycans in cancer
    101084342 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    101084342 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084342 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101084342 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    101084342 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    101084342 (CAMK2A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101084342 (CAMK2A)
   05415 Diabetic cardiomyopathy
    101084342 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101084342 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101084342 (CAMK2A)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101084342 (CAMK2A)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101084342 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 101084342
NCBI-ProteinID: XP_011284381
UniProt: M3W0P7
LinkDB
Position
A1:198917210..198977768
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctcggtggtgcgcaggtgtgtgaaggtgctggctggccaggagtatgct
gctaagatcatcaacaccaagaagctgtcggccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgttgaagcaccccaacatcgtccggctccacgacagcatctct
gaggagggacaccattacctgatcttcgacctggttactggtggggagctgtttgaggac
atcgtggcccgggagtattacagtgaggctgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggtgtggtgcaccgggacctgaagccggagaat
cttctgttggcttccaagctcaagggcgccgcggtgaagctggcggactttggcctggcc
atagaggtggaaggggagcagcaggcatggttcgggttcgcagggacgcctggatacctc
tccccggaagtgctgcggaaggacccttatgggaagcctgtggacctgtgggcctgtggg
gtcattctgtacatcctgctggttgggtatccgccattctgggatgaggaccagcaccgc
ctgtatcagcaaatcaaagccggcgcctatgatttcccgtcaccagaatgggacactgtc
accccggaagccaaggatctgatcaataagatgctgaccatcaacccatccaaacgcatc
acggccgccgaggccctcaagcacccttggatctcgcatcggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggagccatccttaccacaatgctggctaccaggaacttctctggagggaagagcggagga
aacaagaagaatgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagtaccaataccaccattgaggatgaagacaccaaagtgcggaaacaggag
attataaaagtgacagagcagctgatcgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccctgggatgacagccttcgaacccgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacttgtggtctcggaacagcaagccc
gtgcacaccaccatcctgaacccccacatccatctgatgggtgacgagtcggcctgcatc
gcctacatccgcatcacgcagtacctggatgcgggtggcatcccccgcacggcccagtcg
gaggagacccgtgtctggcaccgccgggatggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccattga

KEGG   Felis catus (domestic cat): 101098090
Entry
101098090         CDS       T02385                                 
Symbol
CAMK2G
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X16
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04114  Oocyte meiosis
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101098090 (CAMK2G)
   04310 Wnt signaling pathway
    101098090 (CAMK2G)
   04066 HIF-1 signaling pathway
    101098090 (CAMK2G)
   04020 Calcium signaling pathway
    101098090 (CAMK2G)
   04024 cAMP signaling pathway
    101098090 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101098090 (CAMK2G)
   04217 Necroptosis
    101098090 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101098090 (CAMK2G)
   04922 Glucagon signaling pathway
    101098090 (CAMK2G)
   04912 GnRH signaling pathway
    101098090 (CAMK2G)
   04921 Oxytocin signaling pathway
    101098090 (CAMK2G)
   04916 Melanogenesis
    101098090 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    101098090 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098090 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    101098090 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    101098090 (CAMK2G)
   04728 Dopaminergic synapse
    101098090 (CAMK2G)
   04720 Long-term potentiation
    101098090 (CAMK2G)
   04722 Neurotrophin signaling pathway
    101098090 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    101098090 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    101098090 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    101098090 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098090 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098090 (CAMK2G)
   05205 Proteoglycans in cancer
    101098090 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    101098090 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098090 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101098090 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    101098090 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    101098090 (CAMK2G)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101098090 (CAMK2G)
   05415 Diabetic cardiomyopathy
    101098090 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098090 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101098090 (CAMK2G)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101098090 (CAMK2G)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101098090 (CAMK2G)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal SnoaL_2 Kdo ABC1
Other DBs
NCBI-GeneID: 101098090
NCBI-ProteinID: XP_019668882
Ensembl: ENSFCAG00000018407
LinkDB
Position
D2:complement(36388882..36444871)
AA seq 506 aa
MPTFETSKHCVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENL
LLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGV
ILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRIT
ADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQSSA
PASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQ
TAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSA
GMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGM
DFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEET
RVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgccgacttttgaaacatccaaacattgtgttaccggcggggagctgtttgaagacatc
gtggccagagagtactacagtgaagctgatgccagccactgtatacatcagatcctggag
agtgttaaccacatccaccagcatgacatcgtccaccgggacctgaagcctgaaaacctg
ctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgattttggcctagccatt
gaagtacagggagagcagcaggcttggtttggttttgctggcaccccgggttacttgtcc
cctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgcggggtc
atcctgtatatcctcctggtgggataccctcccttctgggatgaggatcagcacaagttg
tatcagcagatcaaggctggggcctatgatttcccatcaccagagtgggacacggtgact
cctgaagccaagaacttaatcaaccagatgctgaccataaaccctgcgaagcgcatcaca
gctgaccaggctctcaagcatccatgggtctgccaacgatccacggtggcgtccatgatg
catcgtcaagagactgtggagtgcttgcgcaagttcaatgcacggagaaaactgaagggt
gccatcctcacgaccatgcttgtctccagaaacttctcagttggcaggcagagctccgcc
cccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagcctactg
aacaagaagtcggacggcggtgtcaagaaaaggaagtcgagttccagcgtgcacctaatg
ccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagcccgcgcccttgcag
acggccatggagccacaaaccaccgtggtgcacaatgctacagatgggatcaagggctcc
acagagagctgcaacaccaccacagaagatgaagacctcaaagctgccccgctccgcact
gggaatggcagctcggtgcctgaaggacggagctcccgggacagaacagccccctctgca
ggcatgcagccccagccttctctctgctcctcagccatgcggaaacaggagatcattaag
atcacagaacaactgattgaggccatcaacaatggggactttgaagcctacacgaagatt
tgcgatccaggcctcacttcctttgaacctgaggcccttggtaacctcgtggaggggatg
gatttccataagttttactttgagaatcttctatccaagaacagcaagcccatccacacc
accatcctgaacccgcacgtccacgtgattggggaggacgcagcttgcatcgcctacatc
cgcctcacccagtacatcgatgggcagggtcggcctcgcaccagccagtcggaggagacc
cgggtctggcaccgccgggatggcaagtggctcaatgtccactatcactgctcaggagcc
cctgctgcaccgctgcagtga

KEGG   Felis catus (domestic cat): 101098221
Entry
101098221         CDS       T02385                                 
Symbol
CAMK2D
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X5
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04114  Oocyte meiosis
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101098221 (CAMK2D)
   04310 Wnt signaling pathway
    101098221 (CAMK2D)
   04066 HIF-1 signaling pathway
    101098221 (CAMK2D)
   04020 Calcium signaling pathway
    101098221 (CAMK2D)
   04024 cAMP signaling pathway
    101098221 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101098221 (CAMK2D)
   04217 Necroptosis
    101098221 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101098221 (CAMK2D)
   04922 Glucagon signaling pathway
    101098221 (CAMK2D)
   04912 GnRH signaling pathway
    101098221 (CAMK2D)
   04921 Oxytocin signaling pathway
    101098221 (CAMK2D)
   04916 Melanogenesis
    101098221 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    101098221 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098221 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    101098221 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    101098221 (CAMK2D)
   04728 Dopaminergic synapse
    101098221 (CAMK2D)
   04720 Long-term potentiation
    101098221 (CAMK2D)
   04722 Neurotrophin signaling pathway
    101098221 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    101098221 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    101098221 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    101098221 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098221 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098221 (CAMK2D)
   05205 Proteoglycans in cancer
    101098221 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    101098221 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098221 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101098221 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    101098221 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    101098221 (CAMK2D)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101098221 (CAMK2D)
   05415 Diabetic cardiomyopathy
    101098221 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098221 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101098221 (CAMK2D)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101098221 (CAMK2D)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101098221 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 101098221
NCBI-ProteinID: XP_006930960
Ensembl: ENSFCAG00000018151
UniProt: A0A5F5XU46
LinkDB
Position
B1:111873394..112189308
AA seq 533 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPSCIPNGKENFSGSTSLWQNI
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcttcgactacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggctttctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaaga
gaagctagaatttgccgtcttttgaagcaccctaatattgtgcgacttcatgacagcata
tcagaagagggcttccattatttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcgagagaatattacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcacacccggatat
ctttctccagaagttttacgtaaagatccttatggaaaaccagtggatatgtgggcatgc
ggtgtcattctctatatccttctggtgggatatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagagtgggacaca
gtgactcctgaagccaaagacctaatcaataaaatgcttactatcaatcctgccaagcgt
atcacagcctcagaggcactgaaacacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagacggtagactgcctgaagaaatttaatgctagaagaaaacta
aagggcgccatcttgacaactatgctggctacgaggaatttttcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggagccccaaactactgttatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagaaattatcaaagtcactgaacaactgattgaagctatcaacaatggggacttt
gaagcttacacaaaaatctgtgacccgggccttactgcttttgaacctgaagctttgggt
aatttagtggaagggatggactttcaccgattctactttgaaaatgctttgtccaaaagc
aataaaccaatccacactattatcctgaacccccatgtacacctggttggtgatgatgct
gcctgcatagcgtacattaggctcacacagtacatggatggcagcgggatgccaaagaca
atgcagtcagaagaaacccgtgtgtggcaccgccgggatggaaagtggcagaatgttcat
tttcatcgctctgggtcgccaacagtacccatcaagccatcctgtattccaaatgggaaa
gaaaacttctcaggaagcacctctttgtggcaaaacatctaa

KEGG   Felis catus (domestic cat): 101098615
Entry
101098615         CDS       T02385                                 
Symbol
CAMK2B
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04114  Oocyte meiosis
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101098615 (CAMK2B)
   04310 Wnt signaling pathway
    101098615 (CAMK2B)
   04066 HIF-1 signaling pathway
    101098615 (CAMK2B)
   04020 Calcium signaling pathway
    101098615 (CAMK2B)
   04024 cAMP signaling pathway
    101098615 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101098615 (CAMK2B)
   04217 Necroptosis
    101098615 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101098615 (CAMK2B)
   04922 Glucagon signaling pathway
    101098615 (CAMK2B)
   04912 GnRH signaling pathway
    101098615 (CAMK2B)
   04921 Oxytocin signaling pathway
    101098615 (CAMK2B)
   04916 Melanogenesis
    101098615 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    101098615 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098615 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    101098615 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    101098615 (CAMK2B)
   04728 Dopaminergic synapse
    101098615 (CAMK2B)
   04720 Long-term potentiation
    101098615 (CAMK2B)
   04722 Neurotrophin signaling pathway
    101098615 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    101098615 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    101098615 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    101098615 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098615 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098615 (CAMK2B)
   05205 Proteoglycans in cancer
    101098615 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    101098615 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098615 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101098615 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    101098615 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    101098615 (CAMK2B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101098615 (CAMK2B)
   05415 Diabetic cardiomyopathy
    101098615 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098615 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101098615 (CAMK2B)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101098615 (CAMK2B)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101098615 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH SnoaL_2 Pkinase_fungal Kdo SnoaL_4
Other DBs
NCBI-GeneID: 101098615
NCBI-ProteinID: XP_023105880
Ensembl: ENSFCAG00000019129
LinkDB
Position
A2:complement(62501852..62582721)
AA seq 607 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADAVKPQTNSTK
NSAAVTSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKALRVPDILSSTR
RGSGALEAEGPLPTLSPRLSDILNTVKRGSGALEVQGPPSCPSSALPGPPPTPSRKQEVI
KITEQLIEAVNSGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIH
TTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSG
APVAPLQ
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggccactacggtgacctgtacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccggcgctgtgtcaagctctgcactggtcatgaatac
gcagcaaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcgaatctgccgccttctgaagcattccaacattgtgcgtctccacgacagcatc
tctgaagaggggttccactacctggtctttgatctggtgacaggtggggagctcttcgag
gacattgtggccagagagtactacagcgaggcggatgccagtcactgcatccagcagatc
ctggaggcggttctccattgccaccaaatgggggtcgtccacagggacctcaagcctgag
aacctgctcctggccagcaagtgcaaaggggctgcagtgaagctggcggacttcggcctg
gccatcgaggtgcagggggaccagcaggcgtggtttgggttcgctggcacgccaggctac
ctgtccccagaggtcctgcgcaaggaagcatatggcaagccggtggacatctgggcgtgc
ggggtgatcctgtacatcctgcttgtgggctacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggcgggggcctacgattttccatcccccgagtgggacacg
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccccgccaagcgc
attaccgcacacgaggcgctgaagcacccgtgggtctgccaacgctccactgtggcctct
atgatgcacaggcaggagactgtggagtgcctgaagaagttcaatgcccgaagaaagctt
aagggtgccatcctcaccactatgctggccacgagaaatttctcagtgggcagacagacc
accgctccagccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagcttactcaacaagaaagcggacgcggtgaagccccagacgaacagcaccaaa
aacagtgcagctgtgaccagccctaaggggacactccctccagccgccctggagcctcaa
accaccgtcattcataaccctgtggacgggatcaaggagtcgtcggacagcacccacacc
accatagaggacgaagacacaaaagccctcagggtccctgacatcctgagctccacgagg
aggggctcgggggccctggaagctgaaggccccctgcccactctgtcccccaggctctct
gacatcctgaacacagtgaagaggggctcaggggctctggaagtccagggccccccatcc
tgcccatcttcggctctcccaggccccccgcccaccccgtcgcggaagcaggaggtgatc
aagatcacggagcagctcatcgaggcggtcaacagcggggacttcgaagcctacgcgaaa
atctgtgacccaggcctgacctcgttcgagcctgaagccctgggcaatctggtggaaggg
atggatttccacagattctacttcgagaacctgctcgccaagaacagcaagcccatccac
acgaccatactgaacccgcacgtgcacgtcatcggggaggacgctgcatgcatcgcctac
atccgcctcacgcagtacatcgatgggcagggccggccccgcaccagccagtccgaggag
acacgcgtgtggcatcgccgtgatggcaagtggcagaacgtgcacttccactgctcgggc
gcgcccgtggccccgctgcagtga

DBGET integrated database retrieval system