KEGG   Felis catus (domestic cat): 101084377
Entry
101084377         CDS       T02385                                 
Symbol
JAK1
Name
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101084377 (JAK1)
   04151 PI3K-Akt signaling pathway
    101084377 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101084377 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101084377 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101084377 (JAK1)
   04658 Th1 and Th2 cell differentiation
    101084377 (JAK1)
   04659 Th17 cell differentiation
    101084377 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101084377 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084377 (JAK1)
   05203 Viral carcinogenesis
    101084377 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101084377 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101084377 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084377 (JAK1)
   05161 Hepatitis B
    101084377 (JAK1)
   05160 Hepatitis C
    101084377 (JAK1)
   05171 Coronavirus disease - COVID-19
    101084377 (JAK1)
   05164 Influenza A
    101084377 (JAK1)
   05162 Measles
    101084377 (JAK1)
   05168 Herpes simplex virus 1 infection
    101084377 (JAK1)
   05163 Human cytomegalovirus infection
    101084377 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101084377 (JAK1)
   05169 Epstein-Barr virus infection
    101084377 (JAK1)
   05165 Human papillomavirus infection
    101084377 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084377 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084377 (JAK1)
   05140 Leishmaniasis
    101084377 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101084377 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101084377 (JAK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101084377 (JAK1)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101084377 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 RIO1 SH2 Endonuclea_NS_2
Other DBs
NCBI-GeneID: 101084377
NCBI-ProteinID: XP_006934863
Ensembl: ENSFCAG00000001953
UniProt: A0A2I2U8B7
LinkDB
Position
C1:complement(53819644..54059471)
AA seq 1156 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRMITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPDDSGNILYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKWKKLENKHKKDEEKNKIRE
EWNNFSYFPEITHIVIKECVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHH
YLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTC
FEKSEVVGSLKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMNHLKKQILRTDNISFVLKR
CCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGTL
LDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLL
AREGIDSEFGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTT
LWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIM
RDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTG
EQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSG
SLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDF
GLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDS
SPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPANRTTF
QNLIKGFEALLEALLK
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagacggaggtgaatctggaggcccccgaaccaggggtggaagtgctcttc
tatctgtccgatagggagccgctccggctgggcagcggggagtacacggcagaggagctg
tgcatcagggcggcgcaggaatgctgtatctctcctctgtgtcacaacctttttgccctg
tatgatgagaacaccaagctttggtatgctccgaatcgcatgatcacagttgacgacaag
acatcactccggctccactaccggatgaggttctatttcaccaactggcatgggaccaat
gataatgagcagtctgtatggcgacattctccgaagaagcagaaaaatggctacgagaaa
aaaaaagttccagatgcaacccctctccttgacgccagctccctggagtatctgtttgct
cagggacaatatgatttggtcaaatgcctggctcccattcgagaccccaagaccgagcag
gatggacacgatattgagaacgagtgtctgggaatggctgtcctggccatctcccactac
gccatgatgaagaagatgcaattgccagaactgcccaaggacatcagctacaagcgatat
atcccagaaacattgaataagtccatcaggcagaggaatcttctcaccaggatgcggata
aataacgttttcaaggatttcctaaaggaatttaacaacaagaccatctgtgacagcagt
gtatctactcatgacctgaaggtgaaatacctggcgaccttggagactttgacaaaacat
tatggtgctgaaatatttgagacttccatgttactgatttcgtcagaaaatgagatgaat
tggtttcatccagatgacagtggaaacattctctatgaagtgatggtaactggaaatctt
ggaatccagtggagacagaaaccaaatgttgttcctgttgaaaaggaaaaaaacaaactg
aaatggaaaaagctggaaaataaacacaagaaggatgaggagaaaaacaaaatccgggaa
gagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtgtgtg
gtcagcatcaataagcaggacaataaaaaaatggaactgaagctttcgtcccacgaggag
gccttgtcctttgtgtccctggtagacggctacttccggctcacagcagatgcccatcat
tacctctgcactgatgtggctcccccactgattgtccacaacatacagaatggttgtcac
ggtcccatctgcacggaatatgccatcaataagttgcggcaagaaggaagtgaggaggga
atgtatgtgctgaggtggagctgtaccgactttgacaatatcctcatgactgtcacctgc
tttgaaaaatctgaggtggtgggtagcctgaaacagttcaagaactttcagatcgaggtg
cagaagggccgttacagcctgcatggctcggaccgcagcttccccagcctgggggacctc
atgaaccacctcaagaaacagatcctgcggacggacaacatcagcttcgtgctgaaacgc
tgctgccaacccaagccccgagagatctccaatttgctggtggctactaagaaagcccag
gagtggcagcctgtctactctatgagccagctgagttttgaccggatcctcaagaaagat
atcgtgcaaggagagcaccttgggagaggcacgcggacgcatatctactctggaaccctt
ctggattacaaagatgacgaaggaacttccgaagaaaagagaataaaagtgatcctcaaa
gtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatgatg
aggcaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgagatgtggaa
aatatcatggtggaggagtttgtggagggggggcccctggatctcttcatgcaccggaaa
agcgatgtcctcaccacaccgtggaagtttaaagttgccaaacaactggctagtgccttg
agttacttggaggataaagacctggtccacggaaatgtgtgcactaaaaacctcctcttg
gcccgtgagggcatcgacagtgagttcggcccgttcatcaagctcagtgaccccggcatc
cccatcaccgtgctgtccaggcaagagtgcatagaacgaatcccgtggattgctcccgag
tgtgttgaagactccaagaacctgagtgtggccgctgacaaatggagctttggaaccaca
ctctgggaaatctgctacaatggcgagatccctctgaaagacaagacactgattgagaaa
gagcgattctatgaaagccggtgccggccagtgacaccatcttgtaaggagctggctgac
ctcatgacccgctgcatgaactatgaccccaaccagagacccttcttccgagccatcatg
agagacatcaataaactggaggagcagaatccagacattgtttcggaacgaaagccggca
accgaagtggatcccacacattttgaaaagcggttcttgaagagaatccgtgacttggga
gagggccactttgggaaggttgagctctgcagatacgaccctgagggtgacaataccggg
gagcaggtggctgtcaaatccctgaagcctgagagtggaggtaaccacatagctgatctg
aagaaggaaattgaaatcttaaggaacctctatcatgagaacattgtgaagtacaaaggc
atctgtacagaagacggaggaaatggtattaagctcatcatggagtttctaccttcagga
agccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacaacagttaaaa
tatgctgttcagatttgtaaggggatggactacttggggtctcggcagtacgttcaccgg
gacttagcagcaagaaatgtcctcgttgagagtgagcaccaagtgaaaattggagacttc
ggtttaaccaaagccattgaaaccgacaaagagtactacacagtcaaggatgatcgggac
agccctgtgttttggtatgctccagaatgtttaattcagtgtaaattttatatcgcctct
gacgtctggtcgtttggagtgactctgcatgagctgctcacttactgtgactccgattct
agccccatggcattgttcctgaaaatgataggcccaacgcatggccagatgacagtcaca
agacttgtgaacacgttaaaagaaggaaaacgtttgccctgtccacctaactgcccagat
gaggtttatcaactcatgagaaagtgctgggaattccaaccagctaataggacaactttt
cagaacctaattaaaggatttgaagcacttttagaagcacttttaaaataa

KEGG   Felis catus (domestic cat): 101088959
Entry
101088959         CDS       T02385                                 
Symbol
JAK2
Name
(RefSeq) tyrosine-protein kinase JAK2 isoform X2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04062  Chemokine signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04725  Cholinergic synapse
fca04917  Prolactin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101088959 (JAK2)
   04151 PI3K-Akt signaling pathway
    101088959 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101088959 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101088959 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101088959 (JAK2)
   04659 Th17 cell differentiation
    101088959 (JAK2)
   04062 Chemokine signaling pathway
    101088959 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101088959 (JAK2)
   04917 Prolactin signaling pathway
    101088959 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    101088959 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    101088959 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088959 (JAK2)
   05207 Chemical carcinogenesis - receptor activation
    101088959 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101088959 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101088959 (JAK2)
   05164 Influenza A
    101088959 (JAK2)
   05168 Herpes simplex virus 1 infection
    101088959 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088959 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088959 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088959 (JAK2)
   05140 Leishmaniasis
    101088959 (JAK2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088959 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101088959 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101088959 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101088959 (JAK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101088959 (JAK2)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101088959 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo ABC1 RIO1 APH
Other DBs
NCBI-GeneID: 101088959
NCBI-ProteinID: XP_019671272
Ensembl: ENSFCAG00000028588
UniProt: M3XFX5
LinkDB
Position
D4:complement(6460572..6578790)
AA seq 1043 aa
MGMACLTMTEMEGVSVSPVHQNGDIPGNANSVKQIDPLLQVYLYHSLEKADGEYLKFPTG
EYVAEEICVAASKACGITPVYHSMFALMSETERTWYPPNHVFHVDESTRHNVLYRIRFYF
PYWYCNGSNRTYRHGVSRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKIPVTHETQEECLG
MAVLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIVITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVTIKQGNQEGSNESRIVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERDNVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKLKDKSNLLVFRTNGVSDVPTSPTLQRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSISILWKLEVAKQLAWA
MHFLEEKALIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNRIGTLGFSGAFEDRDP
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEI
LKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQIC
KGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFCL
PGREEQRCSLRRKTRTRGAGTWK
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgggaatggcttgccttaccatgacggaaatggaaggagtatctgtatctcctgtgcat
cagaatggtgatattcctggaaatgctaattctgtgaagcaaatagatccactccttcag
gtgtatctttatcattctcttgagaaggctgatggagaatatctgaagtttccaactggg
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcttgtggaatcacgcccgtg
tatcatagtatgtttgctttaatgagtgaaaccgaaaggacctggtatccgcccaaccat
gtcttccatgtagatgaatcaaccaggcacaacgtactctacagaataagattttacttt
ccttactggtattgtaatggcagcaacagaacctatcggcatggagtgtctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctttttgctcagtggcggcatgat
tttttacatggatggataaaaataccggtgactcatgaaacgcaggaagaatgtcttgga
atggcagtgttagatatgatgagactagccaaagagaaggatcaaaccccattggacatc
tatagctctatcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagac
tatcatattttgacaaggaagagaataaggtatagatttcgcagatttattgagcagttc
agccactgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaaca
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattgtaataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgtgacttt
cctgatatcattgatgtgactattaaacaaggaaaccaagaaggctcaaatgaaagtaga
attgtaactatccataagcaagatggtaaaaatctggaaattgaactaagctcattaaga
gaagctttatcctttgtgtcattaattgatggctattacagattaaccgcggatgcacat
cattacctctgtaaagaagtagctcctccgatggtgcttgaaaatatacaaagcaactgt
catggcccgattttaatggattttgccatcagtaaactgaagaaagcaggtaatcagact
ggactctatgtacttcgatgcagtcctaaggactttaataaatattttctgacttttgct
gtcgagcgagataatgtcatcgaatataagcattgtttgattacaaaaaatgagaacgga
gaatacaacctcagtgggaccaagaagaacttcagtaatcttaaagatcttttgaattgc
taccagatggaaactgttcgctcagacagtataattttccagtttactaaatgctgcccc
ccaaagttgaaagataaatcaaatcttctagtctttagaaccaatggcgtttctgatgta
ccaacatcaccaacattacagaggcataataatgtgaaccaaatggtgtttcacaaaatc
agaaatgaagatttaatatttaatgaaagccttgggcaaggcacttttacaaaaattttt
aaaggtgtaagaagagaagtaggagactatggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacacagaaactattcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaagcacctggttttaaattatggagtatgtgtctgtggagag
gaaaatattctggttcaggagtttgtaaaatttggatcattagatacatacctgaaaaag
aataaaaattctataagtatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaagcccttattcatgggaatgtgtgtgccaaaaatattctg
cttatcagagaagaagacagaaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaacttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagacaagcctctgagtgctttggattctcaa
agaaagctccagttttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataactgtatggattatgaaccagattttagaccttctttcagagcc
atcatacgagatcttaatagtttgtttactccagattacgagctattaacagaaaatgac
atgttgccaaataggataggcacccttgggttttctggagcttttgaagaccgagacccg
acacagtttgaagagagacacttgaaatttctacagcagcttggcaagggcaattttggc
agtgtggagatgtgccggtatgaccctctacaagacaacactggggaggtggtggccgtg
aagaagctccagcacagtactgaggagcacctgagagactttgaaagagaaattgaaatc
cttaaatccctgcagcatgacaacattgtcaagtacaagggagtgtgctacagtgctggc
cggcgtaatttaagattaattatggaatatttaccatatggaagtttacgagattatctc
caaaaacataaagaacggatagatcataaaaaacttctgcagtatacatctcagatatgc
aagggcatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaaggaat
atattggtggagaatgaaaacagggttaaaattggagattttggtttaaccaaagtcttg
ccacaagacaaagaatactacaaagtgaaagaacctggtgaaagtcccatattctgttta
ccaggtagagaagagcaaaggtgttccctgaggaggaagaccagaactagaggggcaggg
acttggaagtga

DBGET integrated database retrieval system