KEGG   Felis catus (domestic cat): 101084469
Entry
101084469         CDS       T02385                                 
Symbol
HCLS1
Name
(RefSeq) hematopoietic lineage cell-specific protein
  KO
K06106  cortactin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04530  Tight junction
fca05100  Bacterial invasion of epithelial cells
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101084469 (HCLS1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101084469 (HCLS1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101084469 (HCLS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084469 (HCLS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101084469 (HCLS1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    101084469 (HCLS1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101084469 (HCLS1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101084469 (HCLS1)
SSDB
Motif
Pfam: HS1_rep SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 101084469
NCBI-ProteinID: XP_003991734
Ensembl: ENSFCAG00000015524
UniProt: M3WMS6
LinkDB
Position
C2:complement(67517471..67543691)
AA seq 494 aa
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRAEHINIHQLRNK
VSEEHDILKKKEMDSGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAARGF
GGKYGVEKDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGIEKDKRDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESMAEEKRKWEEEEKAQQIARQQQERKALVKKSHEAKQPVDTVGEPEVPAPLPKKISS
EAWPPAGSCPPSEPGPVRTSREHPVPTLPLRQNPPEDEEPPALPPRTLEGLQLEEEPVYE
VEPEPEPEPEPEPQPKSEPEPETEPETENDYEDIGDMDRCEQDGEPDGDYEDVLEPENPS
FASTMAESSGYPAGAGAGISAIALYDYQGEGSDEISFDPDDIITDIEMVDEGWWRGRCHG
HFGLFPANYVKLLQ
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtggaagtctgtagtagggcatgatgtatctgtttctgtggagacccagggtgatgat
tgggacacagaccctgactttgtgaatgacatctctgaaaaggagcaacggtggggagcc
aagaccattgaaggctctggacgtgcagaacatatcaatatccaccagctgaggaacaaa
gtgtcagaggagcatgatattctcaagaagaaggagatggactcagggcccaaagcatcc
catgggtatggaggtcggtttggggtggagagagaccgaatggacaagagtgccgtgggc
catgaatatgttgctgaggtggagaagcactcttctcagactgatgctgccagaggcttt
ggaggcaaatatggagttgagaaggacagggcagacaagtcggcagttggctttgattac
aaaggagaagtggagaagcatgcatctcagaaagattactctcatggctttggaggccgt
tatgggatagagaaggataaacgggacaaagcagctctgggatatgactacaagggagag
acagagaaacatgagtcccagagagattatgccaagggctttggcggtcagtatggaatc
cagaaggaccgagtggataagagtgctgttggcttcaatgaaatggaggctccaactaca
gcttataaaaagacgacacccatagaggctgcttctagtggtgctcgtgggttgaaggca
aaatttgagtccatggctgaggagaagaggaagtgggaggaagaagaaaaggcacagcag
atagccaggcagcaacaggagagaaaggccctggtaaagaagagccatgaggctaagcag
ccagtagacactgtgggagagccagaggtgccagccccattgcccaagaaaatctcttca
gaggcctggcctccagcagggagctgtccaccatcagagcctgggcctgtgagaaccagt
agggaacacccagtgcctaccctgcccctgaggcagaatcccccagaggatgaggagccc
ccagccctgcctcccaggactctggaaggcctgcagctggaggaagagccagtatatgaa
gtagagcctgagcctgagcctgagcctgagcctgagcctcagcccaagtctgagcctgag
cctgagactgagcctgagactgagaatgactatgaggatattggagacatggacagatgt
gagcaggatggtgaaccagatggggactatgaggatgtactcgaacctgagaatccttct
tttgcctccactatggctgaatcatctggctacccagctggggctggagcagggatctca
gcgatagccctgtatgattaccaaggagagggaagtgacgagatttcctttgatcctgat
gacatcatcactgacattgagatggtggatgagggctggtggcggggacgttgccatggc
cactttggactctttcctgcaaattatgtcaagctcctccagtaa

KEGG   Felis catus (domestic cat): 101088615
Entry
101088615         CDS       T02385                                 
Symbol
CTTN
Name
(RefSeq) LOW QUALITY PROTEIN: src substrate cortactin
  KO
K06106  cortactin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04530  Tight junction
fca05100  Bacterial invasion of epithelial cells
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101088615 (CTTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101088615 (CTTN)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101088615 (CTTN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088615 (CTTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101088615 (CTTN)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    101088615 (CTTN)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101088615 (CTTN)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101088615 (CTTN)
SSDB
Motif
Pfam: HS1_rep SH3_9 SH3_1 SH3_2 TAF4
Other DBs
NCBI-GeneID: 101088615
NCBI-ProteinID: XP_023094740
Ensembl: ENSFCAG00000004767
LinkDB
Position
D1:114356048..114386555
AA seq 502 aa
MWRASAGHAVTIAQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQSLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQVDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKFGIDKDKVDRSAVGFEYRGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNSSTYEDVTQXAPAYQKT
IPVEAANSRTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERREQEEARRQLHEQAQA
QKQTPPASPTPQPAEERPPSSPVYEDAVSFKAEPQPTYSVEAADYREAGGQQGLAYAPDA
VYEAAEAPGHYQAEENTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDG
WWRGLCKGRYGLFPANYVELRQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtggagagcttcggcgggccacgccgtgaccatcgcccaggacgacgggggcgccgat
gactgggagaccgaccccgattttgtgaacgacgtgagtgagaaggagcagagatggggg
gccaagaccgtgcaagggtctgggcaccaggagcacatcaacatacacaagttgagagag
aatgtttttcaagaacaccagagcctgaaggagaaggagcttgaaacgggaccaaaagct
tctcacggttacggcgggaagttcggcgtggagcaggaccgcatggacaagtcagccgtc
ggccacgagtatcagtcgaagctctccaagcactgctcccaggtcgactccgtccggggc
tttggaggcaagtttggtgtccaggtggacagagttgaccagtctgctgtgggctttgag
taccaggggaaaaccgagaaacacgcctcgcagaaagattactcgagtggctttggtggc
aagtacggtgtgcaggcggaccgcgtggacaagagcgccgtgggcttcgactaccagggc
aagacggagaagcacgagtcgcagaaagattactccaagggcttcgggggcaagtttggc
atcgacaaggacaaggtggatagaagcgccgtgggcttcgagtaccgaggcaagacggag
aagcacgaatcccagaaagactatgtgaaagggtttggaggaaagtttggcgtgcagacg
gacagacaagacaaatgtgctcttggctgggatcaccaggagaaattgcagctgcacgag
tcccaaaaagactattccaaaggattcggcggaaaatacggggtgcagaaggatcggatg
gataagaattcttccacctacgaggatgtcacccagngggcccctgcttatcagaagacc
atccccgtcgaagcagcaaacagcagaaccagcaacattagagcgaactttgaaaacctg
gcgaaggagaaggagcaggaggacaggcggaaggcggaagcggagagggcgcagaggatg
gccaaggagagacgggagcaggaagaggcccggaggcagctgcacgagcaagcccaagcc
cagaagcaaaccccccctgcgtctcccacccctcagccggctgaggagaggccgccctca
agccccgtctatgaggacgcggtttcgttcaaggctgagccgcagcccacgtacagcgtg
gaggccgccgactaccgagaggctggtggccagcagggcctggcctacgccccggacgcc
gtctacgaggccgcggaggccccgggccactatcaagcagaggagaacacctacgacgaa
tacgaaaacgaccttgggatcacggctgtcgccctctacgactaccaggctgcgggtgac
gacgagatctccttcgaccccgacgacatcatcaccaacatagagatgatcgatgacggc
tggtggcgggggctctgtaagggcaggtacgggctcttcccggccaactacgtggagctg
cggcagtag

DBGET integrated database retrieval system