KEGG   Felis catus (domestic cat): 101084670
Entry
101084670         CDS       T02385                                 
Symbol
CX3CL1
Name
(RefSeq) fractalkine isoform X1
  KO
K05508  C-X3-C motif chemokine 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04668  TNF signaling pathway
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101084670 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101084670 (CX3CL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101084670 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101084670 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101084670 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101084670 (CX3CL1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101084670 (CX3CL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101084670
NCBI-ProteinID: XP_023100769
Ensembl: ENSFCAG00000004692
LinkDB
Position
E2:36496409..36508298
AA seq 438 aa
MASPPLSWLLRLAALCHLTALLAGQHLGVKKCNVTCSKMTSEIPVALLVHYQRNQESCGK
HAIILRTKQNKIFCADPKEKWVQKAMEHLERQTALPVQNGGTFEKQIGVGEPRTTLAARG
MDKSTVTEPKATRESSGQEAQRALGTSPELSTGVADSWGTRFPSTSKAPDGGPPAGSQRT
ELFNAAALTTPASWQSSAYKPGSGLWAEGKASEALPTQAPATQAPATQAPATQAPPTQAP
STQAPSTQAPPTQAPSTQTLLTQAPSTQTLPTQAPSTQVPTILHTASEDQPVWISGPMPE
NSLGPVEMGPISAHTDALRGSDSMPRLSMVPVSSESVPSREPVASGSWTPKAEEPVHATV
DPQRLEVLITPVPDSQAATRRQAVGLLAFLGLLFCLGVAMFAYQSLQGCPRKMAGDMVDG
LRYVPRSCGSNSYVLVPV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcttcaccacctctctcgtggctgctccgcttggccgccctctgccatctgactgcg
cttctagccggacagcacctcggtgtgaagaaatgcaacgtcacctgcagcaagatgacc
tcggagatccctgtggctttactagtccactaccaacgaaatcaagaatcctgcggcaag
catgccatcatcttgaggaccaaacagaacaaaatcttctgtgctgatccaaaggagaaa
tgggtccagaaagccatggaacatctagagcgccagactgctctgccggtgcaaaatggc
ggcacgttcgagaagcaaattggcgtgggtgaacccaggaccaccctggccgccagggga
atggacaagtctacggtcacagagcccaaagctacccgggaaagcagtggccaggaggcg
cagagggccttggggacttccccagagctgtcgacaggagtggctgattcctgggggacc
aggttcccctccacttcaaaggctccagatggagggcctccagctgggtcccagaggact
gagcttttcaacgccgctgccctcaccaccccggcgtcctggcagagctctgcctacaaa
cctgggtcgggcctctgggctgagggaaaggcctctgaggccctccccacccaggccccc
gccacccaggcccccgccacccaggcccccgccacccaggccccccccacccaggccccc
tccacccaggccccctccacccaggccccccccacccaggccccctctacccagaccctc
cttacccaggccccctccacccagaccctccctacccaggccccctctacccaggtcccc
accattttacacacagcctcagaggaccaacctgtgtggatctctggccccatgccagag
aactctctagggcccgtggagatgggtcccatttcagctcacacggatgctctcagaggg
tctgacagcatgccccgtctctccatggtccctgtctcctcagaaagtgttcccagcagg
gagccagtggcctcaggcagctggacccctaaggctgaggagcccgtccatgccactgtg
gacccccagcggctggaagtcctcatcactcctgtccctgactcccaggcggccacccgg
aggcaggcagtagggctgttggccttcctcggcctcctcttctgcctgggggtggccatg
ttcgcctaccaaagcctccagggctgcccccgcaagatggcaggagacatggtggacggg
cttcgctatgtcccccggagctgcggcagtaactcgtacgtcctggtgcccgtgtga

DBGET integrated database retrieval system