KEGG   Felis catus (domestic cat): 101084908
Entry
101084908         CDS       T02385                                 
Symbol
CRKL
Name
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04935  Growth hormone synthesis, secretion and action
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05211  Renal cell carcinoma
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101084908 (CRKL)
   04012 ErbB signaling pathway
    101084908 (CRKL)
   04015 Rap1 signaling pathway
    101084908 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101084908 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101084908 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101084908 (CRKL)
   04062 Chemokine signaling pathway
    101084908 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101084908 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    101084908 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101084908 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084908 (CRKL)
   05206 MicroRNAs in cancer
    101084908 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101084908 (CRKL)
   05211 Renal cell carcinoma
    101084908 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101084908 (CRKL)
   05163 Human cytomegalovirus infection
    101084908 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101084908 (CRKL)
   05100 Bacterial invasion of epithelial cells
    101084908 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 101084908
NCBI-ProteinID: XP_003995011
Ensembl: ENSFCAG00000006004
LinkDB
Position
D3:complement(29768298..29808986)
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcagaccgctccgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccatggtatgttcctagttcgcgac
tcctccacctgccctggggattatgtgctgtccgtgtccgagaactcgcgggtctcccac
tacatcatcaactctctgcccaaccgccgttttaagattggggaccaggaatttgaccac
ttgccggccctgctggagttctacaagatccactacctggacaccaccaccctaatcgag
cccgcgcccaggtatccgagcccaccaatgggatctgtatcagcacccaacctgcctaca
gcagaagaaaatctggaatacgtacggactctctatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctggtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgaattgggatgattcctgtcccttatgttgaaaag
cttgtgaggtcctcaccacatggaaagcacgggaataggaattccaacagttatggaatc
ccagaacctgctcatgcatatgctcaacctcagaccacaactcctctacctgcagtttcc
agtactcctggagcagcgatcaaccctttgccatccacacagaatggacctgtctttgca
aaagccatccagaaaagagtaccctgtgcttatgacaagaccgccttggcattagaggtt
ggtgacattgtgaaagtcacaagaatgaatataaatggccagtgggaaggcgaagtgaat
gggcgcaaagggcttttcccctttacgcatgtcaaaatcattgaccctcaaaaccctgat
gaaaacgagtga

KEGG   Felis catus (domestic cat): 101086100
Entry
101086100         CDS       T02385                                 
Symbol
CRK
Name
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04935  Growth hormone synthesis, secretion and action
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05211  Renal cell carcinoma
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086100 (CRK)
   04012 ErbB signaling pathway
    101086100 (CRK)
   04015 Rap1 signaling pathway
    101086100 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101086100 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101086100 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101086100 (CRK)
   04062 Chemokine signaling pathway
    101086100 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101086100 (CRK)
   04935 Growth hormone synthesis, secretion and action
    101086100 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101086100 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086100 (CRK)
   05206 MicroRNAs in cancer
    101086100 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101086100 (CRK)
   05211 Renal cell carcinoma
    101086100 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101086100 (CRK)
   05163 Human cytomegalovirus infection
    101086100 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101086100 (CRK)
   05100 Bacterial invasion of epithelial cells
    101086100 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 101086100
NCBI-ProteinID: XP_023100586
LinkDB
Position
E1:15350157..15376541
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSK
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgtttctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgcccgtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacattatttggacactacaacgttgatagaaccagtttccaaa
tccaggcagggtagtggagtgattctcaggcaggaggaggctgagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat
gaggacttcagctga

DBGET integrated database retrieval system