KEGG   Felis catus (domestic cat): 101085081
Entry
101085081         CDS       T02385                                 
Symbol
RILP
Name
(RefSeq) rab-interacting lysosomal protein
  KO
K13883  Rab-interacting lysosomal protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101085081 (RILP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101085081 (RILP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085081 (RILP)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    101085081 (RILP)
SSDB
Motif
Pfam: RILP Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 101085081
NCBI-ProteinID: XP_006940045
Ensembl: ENSFCAG00000006296
LinkDB
Position
E1:15187997..15191683
AA seq 400 aa
MEPRGTIPGVPGCGPRVAAGSGTAAELVYHLAGALGTELKELARRFGPEAAARLVPLVVR
ALELLEKAAVGPDPDSLQVSAQQAELELRRLREENEHLRRQLHSGPHEERALLRQLKEVT
DRQRDELRAHNRDLLQRSQETEALQEQLQRLLLVNSELRHKLAAVQTQLRAARDREGERE
LQRQGAVELAQEPAQDQARGAGYEQRQEPERATAEAGAPGTPEDPPGRPSKVGQCSFSRE
ELEQILQERNELKANVFLLKEELAYFQRELLTDQRVPGLLVEAMKVAVKKQRKKIKAKML
GIPEEAESSDDEDSSWLLLSSDKGAHPPPTESRIQSFFGLSYRGETEAPEAQTSSMAPSK
LGGEEEAAPQSSTPDQPCSALDEHLCLSCPRDLTLESGYG
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggagcccagggggacgatacccggggtgcctggctgcgggcctcgagtggccgccggg
tcagggacggccgcggagctcgtgtaccatctagcaggggccctgggcacggagctgaaa
gagctggcgcgccgcttcgggccggaggcggcggccaggctagtgccgctcgtggttcgg
gcgctggagctcctggaaaaggctgccgtggggcccgacccggactcactgcaggtgtca
gcgcagcaggccgaactagagctgcggcggctgcgcgaggagaacgagcacctccgcaga
cagctgcactctgggccacacgaggagcgcgctctcctgcggcagctcaaggaggtgacc
gaccgccagcgagacgagctccgggcgcacaaccgcgacctgctgcagcgcagccaggag
acggaggcgctgcaggagcagctgcagcgcctcctgctggtgaattcagagctgcggcac
aaactggcagcggtgcaaacccagctgcgtgccgcgagggaccgcgagggcgagcgggag
ctacagcgccagggggcagtggagctggctcaggagccggcgcaggaccaggccaggggg
gccgggtacgagcagaggcaggagcccgagcgggcaaccgctgaggcgggggctccaggg
acccctgaggatccgccagggcgcccctccaaggtaggacagtgcagcttcagtcgagag
gaacttgagcagatccttcaggagaggaatgaactcaaagccaacgtgttcctgctgaag
gaggagttggcctacttccaaagggagctgctcacggaccagcgggtccctgggcttctg
gttgaagccatgaaggtggctgtcaagaagcagcggaagaagatcaaggccaagatgtta
gggattccagaggaagcagagagcagtgacgatgaagacagctcatggctcctactctcc
agtgataagggagcccaccctccacccactgagtcccgaatacagagtttctttggcctg
tcctatcggggtgaaacagaggcccctgaagcccagaccagcagcatggcccccagtaag
ctagggggagaagaggaggcagccccacagtcctcaactcctgaccagccgtgctctgca
ctcgatgaacatctttgtctcagctgccccagagacctgactttggaatctggctatggg
tag

DBGET integrated database retrieval system