KEGG   Felis catus (domestic cat): 101085141
Entry
101085141         CDS       T02385                                 
Symbol
CD58
Name
(RefSeq) lymphocyte function-associated antigen 3 isoform X1
  KO
K06492  CD58 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101085141 (CD58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101085141 (CD58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101085141 (CD58)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101085141 (CD58)
CD molecules [BR:fca04090]
 Proteins
  101085141 (CD58)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Others
  101085141 (CD58)
SSDB
Motif
Pfam: Ig_3 I-set EphA2_TM
Other DBs
NCBI-GeneID: 101085141
NCBI-ProteinID: XP_023114803
LinkDB
Position
C1:complement(100061360..100102261)
AA seq 270 aa
MHTGRDGLLAAGILGVACLVLHLDFISCVPQRIYGTVNTSVTLYTSGSIPIKEIMWKKKK
DKVVEWDEEFLKPRAYPPFVDRVHLDVTSGNLTIFNLTSSDEEDYEVELSGITDTKFTLY
VIEPLPFPTLNCTFTAENITVHCGIPETYSSHINLIKYSWNCFSEQCQNSTNSSEVSIKR
ESDLSQEIQCIISNPLSKQASSLVLATCVPDNSRHSFVIIASVLFVVILAMFVLLCRRDF
LKRDGERDRTEKEAINDRNSDPTSRLHATP
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcacacggggagagacgggctcttggccgcggggattctcggtgtggcctgtctggtg
ctccatttggacttcatcagctgtgttccccagcggatatacggaactgtaaacacgagc
gtaactttgtacacatcgggctctatacccattaaagagataatgtggaaaaaaaaaaaa
gataaagtcgtagaatgggatgaagaattcttaaagcccagagcttacccaccgtttgta
gatagggttcatctggacgtcacatcaggaaaccttaccatcttcaatctaacatcatcg
gatgaagaggactatgaagtcgaactttcaggcattaccgataccaagttcaccctttac
gtgattgagcctcttccatttccaacactaaattgcacattcactgccgaaaacattaca
gtccactgcgggatcccggaaacctacagcagccatataaaccttataaagtactcctgg
aattgcttctcggaacagtgtcaaaatagcaccaattcatctgaagtttctattaagagg
gaaagtgatctctcacaggaaatacagtgtatcatcagtaatccgttgtccaaacaggca
tcatcactggttttagcaacctgtgtcccagataattcaaggcacagttttgtgattata
gcatcagtgttatttgtggtgatactggcaatgtttgtattgctgtgtagaagagatttt
ctgaaacgtgatggagaaagagacagaaccgagaaagaagccataaatgacaggaattct
gaccccacgagccggttgcatgccaccccgtag

DBGET integrated database retrieval system