KEGG   Felis catus (domestic cat): 101085148
Entry
101085148         CDS       T02385                                 
Name
(RefSeq) serotransferrin
  KO
K14736  transferrin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04066  HIF-1 signaling pathway
fca04216  Ferroptosis
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101085148
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101085148
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    101085148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085148
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101085148
  Exosomal proteins of colorectal cancer cells
   101085148
SSDB
Motif
Pfam: Transferrin Phosphonate-bd
Other DBs
NCBI-GeneID: 101085148
NCBI-ProteinID: XP_019666242
LinkDB
Position
C2:complement(131302056..131327252)
AA seq 708 aa
MRLAVRALLACAVLGLCLAVSPEKTVRWCTVSNHEASKCSSFSENMKTVLETGPFVSCVK
KTSYLECIRAISTNEADAVTLDAGLVFEAGLHPYNLKPVVAEFYESQDDKKTHYYAVAVV
KKTSDFNLDQLQGKKSCHTGLGRSAGWNIPMGLLYWKLPEPRDSLLRAASNFFMSSCVPC
VDRTTFPQLCQLCVGKDTEKCACSNHEPYFGYSGAFKCLMDDAGQVAFVKHSTVLENLPN
KADRDQYELLCRDNSRKSVDRYEDCYLARVPSHAVVARSVGGKEDLIWELLNQAQEHYGK
DKSTAFQLFSSTLGKDLLFKDSAQGLLRIPPKMDTWLYLGYEYVTALRNLREDMRSDTSK
DECKKVKWCAISHHEKAKCDTWSVNSVGKIECETAESTEDCIAMIAKGEADAMSLDGGFI
YIAGQCGLVPVLAENYNNEDPECSNKPEKGYLAVAVVKKSADASLTWNNLKGRKSCHTAV
DRTAGWNIPMGLLYNRINSCEFDKIFEQSCAPGSMRNSSLCALCVGSAKIPGKECIPNSH
ERYYGYTGAFRCLVEKGDVAFVKDQTVKENTGGNNSEDWAKDLKMEDFMLLCPDGSRKTV
KEAEKCFLAHAPNHAVVSRKDMAACVSKTLLDQQKLFGKTENDCSSQFCMFQSETKDLLF
KDDTKCLAKLPEGTTYKSYLGAEYITAVANLRQCSTSKLLEACTFHKD
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaggcttgccgtccgcgccctgctggcctgcgcggtcctggggctgtgtctggctgtc
tcccctgagaaaactgtgagatggtgcactgtctcaaatcatgaagccagtaagtgctcc
agtttcagcgaaaatatgaaaacggtccttgagactggtccctttgtcagctgtgtgaag
aaaacctcctaccttgagtgcatcagggccatttcgacaaatgaagcagatgctgtgaca
ttggatgcaggtttggtgttcgaggcgggcctccacccctacaacctaaagcctgtagtg
gcagagttctatgagtcacaagatgataaaaaaacccactattatgctgtggctgtggtg
aaaaagaccagtgacttcaatctggaccagctccaaggcaagaaatcctgccacacaggc
cttggcaggtctgctgggtggaacatccccatgggcttactttattggaagttgcctgag
ccacgtgactctcttctgagggcagcgtccaatttcttcatgagcagctgtgttccctgt
gtggatcggacaaccttcccccaactgtgtcaactgtgtgtgggaaaagacacagaaaag
tgtgcctgctccaaccatgaaccatacttcggctactcaggtgccttcaagtgtctgatg
gatgacgctgggcaagtggcctttgtcaagcactccacagtactggagaacctgccaaac
aaagctgacagggaccagtatgagctgctctgccgggacaactcccggaagtcagtggat
agatatgaggactgctacctggccagggttccttcccacgctgttgtggcccgaagtgtg
gggggcaaggaggacttgatctgggagcttctcaaccaggcccaggaacattatggcaaa
gacaaatctacagccttccagctcttcagctcaactttggggaaggacctgctgtttaag
gactctgcccaagggcttttaaggattccccctaaaatggacacctggctgtacctggga
tatgagtatgtcactgctcttcggaatctaagggaagatatgcgctctgatacctcaaag
gatgaatgcaagaaggtgaaatggtgtgcaataagtcaccatgagaaggccaagtgtgac
acgtggagtgtaaacagcgtagggaaaatagagtgtgaaacagccgagtccaccgaagac
tgtattgccatgatcgcgaaaggagaggctgatgccatgagcttggatggaggcttcatc
tacatagcaggccagtgtggtctagtgcctgtcctggcagagaactacaacaatgaagac
cctgagtgtagcaacaagccagagaaagggtatcttgctgtggctgtggttaaaaaatca
gcagatgcatccctcacctggaacaatctgaaaggcaggaagtcctgccacactgcagta
gatagaactgctggctggaacatccccatgggcctgctctacaacaggatcaacagctgt
gaatttgataaaattttcgaacagagctgtgcccctggatctatgcgaaattccagtctc
tgtgctctgtgtgttggctcggcaaaaattccaggaaaggagtgtattcccaatagccat
gagagatactatggttacacgggggctttcaggtgtctggttgagaagggagatgtggcc
tttgtgaaagaccagactgtcaaggagaacactgggggaaataacagtgaagattgggct
aaggatctgaagatggaagactttatgctgctgtgtcctgatggcagcaggaagactgtg
aaagaggctgaaaaatgcttcctagcccatgccccgaatcacgctgtggtctcacggaaa
gatatggcagcttgtgttagcaaaacattacttgatcagcagaagttgtttggaaaaact
gaaaatgactgctcgagccagttctgtatgttccaatcagaaaccaaggaccttctgttc
aaggatgacacaaaatgtttggccaaacttccggaaggcacaacatataaatcttactta
ggagcagagtatatcacagctgttgctaacctgagacagtgctccacctcaaaactcctg
gaggcctgtactttccacaaagattaa

KEGG   Felis catus (domestic cat): 101087599
Entry
101087599         CDS       T02385                                 
Name
(RefSeq) inhibitor of carbonic anhydrase-like
  KO
K14736  transferrin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04066  HIF-1 signaling pathway
fca04216  Ferroptosis
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101087599
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101087599
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    101087599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087599
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101087599
  Exosomal proteins of colorectal cancer cells
   101087599
SSDB
Motif
Pfam: Transferrin Phosphonate-bd Consortin_C
Other DBs
NCBI-GeneID: 101087599
NCBI-ProteinID: XP_006936466
Ensembl: ENSFCAG00000027859
UniProt: M3X260
LinkDB
Position
C2:complement(131349907..131408349)
AA seq 698 aa
MKFAICSLLCAGTLGLCLAVPGKTVRWCTVSNHEASKCSDFSDNMKKVLPADGPHVTCVK
RASHFECIKSIWANEADAVTVEGGLVFEAGLLPFNLKPIVAEFFGSKDDPQTYHYAVAVV
KKDSDFQLNQLRGKKSCHTGLGWSAGWNIPIGVLLPSDSIEKATAEMAEFFSGSCVPCAN
RTAFPRLCQLCVGKGTDKCACSFQEPYFGYSGAFKCLQDGVGDVAFVRHMTVFENLPNKA
DRDQYELLCLDNSRKSVDEYKDCHLAHFPSHAVVARKVGGKEDLIWELLNQAQEHFGKDK
PTEFQLFASPHGKDLLFTDATDGFLRVPPKMDAKLYLGYKYFAAIQRLRIGVEDSQRVLW
CAVGHHERVKCDEWSAVSGGALQCTTEETIENCIAAIVKGEADAMTLDGGFIYIAGQCGL
VPVLAENYMPKDESRCVNTPMEGYYVVAVVKKPSADLTWNSLQGRKSCHPAVGTSAGWNI
PMGLIYNKTGSCKFDEFFSQSCAPGSDPDSSLCALCSGGNDPAHTCAPNNHEGYYGSSGA
FRCLVEKGDVAFVKDHTVFQNTDGKNTEAWAKDLKHEDFELLCLDGTRKPVTEAQSCHLA
RVPNHAVVSRKDKADFVRRILFNQQELFGRNGFEYRMFQMFESSNKDLLFSDDTACLANL
QDETTYRKYLGPEYLMAIANMKPCLHSELLDACTFHVH
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgaagttcgccatctgctccctgctgtgcgcagggaccctgggtctgtgtctggctgtc
cctgggaaaactgtgaggtggtgcactgtctcaaatcatgaggccagtaagtgctctgat
ttcagtgacaacatgaaaaaagtccttccagcagatggtcctcatgtcacctgtgtgaag
agagcctctcactttgagtgcatcaagtccatttgggcaaatgaagcagatgctgtgact
gtcgaaggaggtttggtgtttgaggcaggcctgctcccttttaacctgaagcccatcgtg
gcagaattctttgggtcaaaagatgatccacaaacctaccattatgctgtagctgtggtg
aagaaggacagcgacttccagctgaaccagctccgaggcaagaagtcttgccacacgggc
ctaggatggtctgctgggtggaacatacccattggggtacttcttccttctgactccatt
gaaaaagccacagcagaaatggccgagttcttctccggcagctgtgtcccctgtgcgaac
aggacagcgttccccagactgtgtcaactgtgtgtggggaaagggacagacaagtgtgcc
tgctccttccaggaaccgtacttcggctactcaggtgccttcaagtgtctgcaggatggt
gtgggggatgtggccttcgtgaggcatatgacagtgtttgagaacctgccaaacaaagct
gacagggaccagtatgagctgctctgcctggacaactcccggaagtcagtggatgaatac
aaggactgtcacctggcccatttcccttctcatgctgtcgtggctcgaaaggtggggggc
aaggaggacttgatctgggagcttctcaaccaggcccaggaacattttggaaaagacaag
ccaacagaattccagctctttgcctctcctcatgggaaggacttgctgtttacagatgct
accgatgggtttttaagagtccctcctaagatggatgccaagctatacctgggatacaaa
tattttgctgccattcagcgtctaaggataggtgtggaagactcccagagggtgctgtgg
tgtgcagtgggccaccatgagagggtcaagtgcgatgagtggagtgctgtaagtggtggc
gctttacagtgtaccacagaggagaccattgagaactgcatcgctgccatagtgaaagga
gaggctgatgccatgactttggatggaggcttcatctacatagcgggccagtgtggtcta
gtgcctgtcctggcagagaactacatgcctaaggatgagtctaggtgtgtgaatacaccc
atggaaggttattacgtcgtggcagtggttaagaaaccaagtgctgacctcacctggaac
tctctgcaaggcaggaagtcctgtcaccccgcagttggtacttctgcaggctggaacatt
cccatgggtttaatatacaacaaaactgggtcctgtaaatttgatgaattcttcagtcaa
agctgtgcccctgggtctgatccagattccagtctctgtgctctgtgcagtggtggcaat
gacccagcccatacttgtgctcccaacaaccatgagggatactacggctccagtggggca
ttcaggtgtctggttgagaagggagacgtggcctttgtgaaggatcacacagtctttcag
aacactgacggaaagaacactgaagcatgggctaaggatctgaagcatgaagactttgag
ctgctgtgcctcgatggtaccaggaaacctgtgactgaagctcagagctgccacctagcc
agagtcccaaatcatgccgtggtctcaaggaaagataaggcagattttgttcgcagaatt
ctcttcaaccaacaggagctctttggaagaaatgggtttgaatacaggatgttccagatg
tttgaatcctcaaacaaggatctgcttttcagtgatgacactgcatgtttggctaacctt
caggatgaaacaacttacagaaaatacttaggaccagagtatcttatggccattgctaac
atgaaaccatgtttacactctgaacttctggatgcctgtacattccacgtacattaa

DBGET integrated database retrieval system