KEGG   Felis catus (domestic cat): 101085582
Entry
101085582         CDS       T02385                                 
Symbol
ENTPD8
Name
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 8
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca00240  Pyrimidine metabolism
fca01100  Metabolic pathways
fca01232  Nucleotide metabolism
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101085582 (ENTPD8)
   00240 Pyrimidine metabolism
    101085582 (ENTPD8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101085582 (ENTPD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101085582 (ENTPD8)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     101085582 (ENTPD8)
CD molecules [BR:fca04090]
 Proteins
  101085582 (ENTPD8)
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 101085582
NCBI-ProteinID: XP_003996175
Ensembl: ENSFCAG00000003587
UniProt: M3W0L3
LinkDB
Position
D4:complement(95952691..95956797)
AA seq 495 aa
MGLTWKPRVLTALLGAAVASGLTTLILILVEATDVLLPTDTKFGIVFDAGSSHTSLFVYR
WPADKENDTGVVSQALVCQAKGPGISSYASNPAQAGESLQGCLEEALALIPEAQQRKTPL
FLGATAGMRLLSQKNSSQARDIFEAVTQVLSKSPLDFWGAELLAGQDEGALGWITINYVL
GMLVKYSFSGEWIQPLEGTLVGALDMGGASTQITFVPGGPILDKSTQTTFRLYGSEHSVY
THSYLCFGRDQMLSRLLAQLVQSSSGPLVRHPCYHSGYWATLSPAALYESPCVHTAAPPE
LAGNLTVEGTGNPGACISALRGLFNFSSCQGRGHCAFNGVYQPPVRGQFYAFSNFYYTFH
FLNLTSKQPLATVNATIWEFCQRPWKQVEASSPGQDRWLRDYCTSGLYILTLLLEGYGFS
EETWPGIEFRKQAGGTEMGWTLGYMLNLTSMIPAEVPAQWRAQSYGIWAAGVVFAVLTLV
VTLGAVAGQLLWPQG
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggggctgacctggaagccgcgggttctcacggcactgctcggggcggcagtggcctca
ggcctcaccacgctcattctcatcctggtggaggccactgatgtcctcctgcccacagac
accaagtttgggattgtgtttgacgcggggtcctcccacacgtccctctttgtgtaccgg
tggccagcagacaaggagaacgacacgggcgtggtcagccaggccctggtctgccaggcg
aaagggcccggaatctcctcctatgcctccaatcctgcacaagccggtgagagcctgcag
ggctgcctggaggaagcgctggcgctgatcccagaggcacagcagcggaagacgcccctg
ttcctgggggccacggctggcatgaggctactcagccagaagaatagctctcaggcaaga
gacatcttcgaggcggtcacccaggtcctgagcaagtcccccctggacttctggggtgct
gagcttctggccgggcaggacgagggtgctttaggttggatcaccattaactacgtcctg
ggcatgctggtcaagtactccttctctggagaatggatccagcctctggaggggacactg
gtgggagccctggacatgggtggagcctccacccagatcacctttgtgcctggaggcccc
atactggacaagagcacccagaccaccttccgcctctacggatctgagcacagtgtctac
acccacagctacctctgcttcgggcgggaccagatgctgagcaggcttctggcacagctg
gtgcagagcagctccggccccctggtccgccacccatgctaccacagcggctactgggcc
acgctgtccccggccgccctctacgagtccccctgtgtgcacacagcagcccctccggag
ctggccgggaacctcactgtggaagggacagggaaccccggggcttgtatctcagccctc
cggggcctcttcaacttctccagctgccagggccgaggacactgtgccttcaatggggtc
taccagccccctgtgcggggccagttctatgccttctcgaacttctactacaccttccac
ttcctgaatctcacctccaagcagccactggccactgtcaacgccaccatctgggagttc
tgccagaggccctggaagcaggtggaggccagctcgcccggacaggaccgctggcttcgt
gactactgtacctcggggctgtatattctcacgctgctgcttgagggctacgggttcagt
gaggagacttggcctggcatcgagttccgcaagcaggctggtggcacggagatgggctgg
acgctgggctacatgctgaacctgaccagcatgatcccggccgaggtgcctgcccagtgg
cgggcacagagctatggcatctgggcggccggggtcgtctttgccgtgctgactctcgtg
gttactctgggggctgtggcaggccagctcctctggccccagggctaa

KEGG   Felis catus (domestic cat): 101096356
Entry
101096356         CDS       T02385                                 
Symbol
ENTPD1
Name
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 1 isoform X2
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca00240  Pyrimidine metabolism
fca01100  Metabolic pathways
fca01232  Nucleotide metabolism
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101096356 (ENTPD1)
   00240 Pyrimidine metabolism
    101096356 (ENTPD1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101096356 (ENTPD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101096356 (ENTPD1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     101096356 (ENTPD1)
CD molecules [BR:fca04090]
 Proteins
  101096356 (ENTPD1)
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 101096356
NCBI-ProteinID: XP_006938097
Ensembl: ENSFCAG00000014012
UniProt: M3WJX1
LinkDB
Position
D2:57219168..57310805
AA seq 510 aa
MEDRKESELKSFCSRNILIILGFSSIMAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHT
SLYIYKWPAEKENDTGVVHQIEECKLKGPGISRYAQRLNEIDAYLTECMERASQVIPKSQ
HQGTPVYLGATAGMRLLRMENEHLADKVLSMVTKSLNNYHFDFHGARIITGQEEGAYGWI
TINYLLGKFTQKLSWLNLKPNGGNSQGTYGALDLGGASTQITFVPQNERIESPSNALHFR
LYGKDYSVYTHSFLCYGKDQALRQKLAKDIQGTNGILRDPCFHPGYEIVMNVSELYSGPC
TKRFEMTLPFDEFLIQGTGNYQQCHESILELFNTSYCPYSHCSFNGIFLPPLHGDFGAFS
AYYYVMEFLNFTSEETPTQEKVIDSMEKFCSQPWNELKTYFGDVKEKYLSEYCFSGAYIL
SLLLNGYHFTADSWKNIHFMGKIHSSSVGWTLGYMLNLTNMIPAEEPLSTPLSHSTYVFL
MVLFSLILVAVAIIGLFIFHKPSYFWKDMV
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggaagatagaaaggagtctgaactgaagagtttttgttctagaaatatactgatcatc
cttggcttctcctctatcatggctgtgattgctttgatcgctgtggggctgacccagaac
aaaccattgccagaaaatgttaagtatgggattgtgctggatgcaggctcttctcacacg
agtttgtacatctataagtggccagcggaaaaggagaatgacacaggggtggtgcaccag
atagaagagtgcaagctgaaaggtcccggaatctcaagatatgctcaaagattaaacgaa
atagatgcttatctgactgaatgcatggaaagagccagtcaagtgattccaaagtcccag
caccaagggacgcctgtttacctgggagctacggcaggcatgcggttgctcaggatggaa
aatgaacacttggcagacaaagtcctgagtatggtgaccaagagcctcaacaactaccac
tttgacttccatggtgctagaatcatcactggccaagaggaaggtgcctatggctggatt
actatcaactatctgctgggaaaattcactcagaagttgagttggctcaacctgaagcca
aatggaggcaattctcagggaacctatggagctttagaccttgggggagcctctacacaa
atcacttttgtgccccaaaacgagaggattgagtctccaagcaacgctctgcactttcgc
ctctatggcaaggactacagcgtgtacacgcacagcttcttatgctatgggaaggatcaa
gcgctcaggcagaaactggccaaggacattcagggtacaaatggaatcctcagggaccca
tgctttcaccctggatatgaaatagtaatgaatgtaagtgaactttacagtggcccctgc
accaagagatttgagatgactcttccattcgatgagtttctaatccaaggcactggaaac
tatcaacaatgccatgaaagcatccttgaactcttcaacactagttactgcccttactcc
cactgttccttcaatgggattttcttgccaccacttcacggggattttggggcattttca
gcttattactatgtgatggagtttttaaactttacatcagaggaaacccctactcaggaa
aaggtgatcgacagtatggaaaagttctgctctcagccttggaacgagctgaagacatat
tttggtgatgtgaaggagaagtacctgagtgaatattgcttttctggagcctatatcctc
tctctccttctgaatggctatcatttcacagctgattcctggaagaatattcatttcatg
ggcaagatccacagcagcagtgtcggatggactctgggctacatgctgaacctgaccaac
atgatccccgctgaggagccgctgtccacacctctctcccactccacatatgtcttcctc
atggtcctcttctccctgatcctggttgcagtggccatcataggcttgtttatctttcac
aagccttcatatttctggaaagacatggtatag

KEGG   Felis catus (domestic cat): 101098083
Entry
101098083         CDS       T02385                                 
Symbol
ENTPD3
Name
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 3 isoform X1
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca00240  Pyrimidine metabolism
fca01100  Metabolic pathways
fca01232  Nucleotide metabolism
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101098083 (ENTPD3)
   00240 Pyrimidine metabolism
    101098083 (ENTPD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098083 (ENTPD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101098083 (ENTPD3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     101098083 (ENTPD3)
CD molecules [BR:fca04090]
 Proteins
  101098083 (ENTPD3)
SSDB
Motif
Pfam: GDA1_CD39 PAG DUF3739
Other DBs
NCBI-GeneID: 101098083
NCBI-ProteinID: XP_023116464
Ensembl: ENSFCAG00000001786
LinkDB
Position
C2:complement(152967988..153012450)
AA seq 529 aa
MFTLLTRQPCEQAGLKALSRTPAIIALVVLILSVVVLVTITLIQFHQKEVLLPGLKYGIV
LDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGKNPQDVPKAFEDCMQKV
QGQIPAHLHRSTRIYLGATAGMRLLRLQNETAANEVLASIQNYFKSQPFDFRGAQIISGQ
EEGIYGWITANYLMGNFLEKNLWHMWVHPNGVETTGALDLGGASTQISFAAGDKVGLNSS
HIMKVSLYGYVYSLYTHSFQCYGRNEAEKRFLAILLQDSPTKTNLINPCYPRNYLTTFTG
GYIFDSLCTADLRPVSYNPEDIITVGGTGDPSLCREKVASLFDFTACRDQEACSFDGVYQ
PKVKGTFVAFAGFYYTASAFNLSGSFSLSAFNSSSWDFCSESWSQLPLLLPRFDEVYARS
YCFSAHYIYHLLVNGYRFTEETWPQIYFKKEVGNSSIAWSLGYMLSLTNQIPAESPLIRL
PMDPPAFVGTLAFFTAVALLCLAFLVYLCASSGKQRRSQHAFDHTVDSE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgttcactctgctgacccgccaaccctgtgagcaagcaggcctcaaggccctctcccga
accccagccatcatcgccttggtggtcttgattttgagtgttgtggtgcttgtgaccatc
acactcatccagtttcaccagaaagaggtcctccttccaggactgaagtatggaatcgtg
ctcgatgccgggtcttccagaaccaccgtctacgtctatcagtggccagcggagaaggag
aataatactggagtggtcagtcaaaccttcaagtgtagtgtgaaaggctctgggatctcc
agctatgggaaaaacccccaagatgtgcccaaagcctttgaggattgcatgcaaaaagtc
caggggcagattccagcccacctccatagatccacccgcatttacctgggggccacggcg
gggatgcgcttgctgaggttacagaatgaaacagcagctaatgaagtccttgccagcatc
caaaactacttcaagtcccagccctttgattttaggggtgctcaaatcatttctgggcaa
gaggaagggatatatggatggattacagccaactatttaatgggaaatttcctggagaag
aacctgtggcatatgtgggtgcatccaaacggagtggagaccacaggtgccctggattta
ggtggtgcctctacccaaatatccttcgcggccggagacaaggtggggctgaacagcagc
cacatcatgaaagtgtccctctacggctacgtgtactcgctctacacacatagcttccag
tgctacggccgcaatgaggctgagaagaggtttctggccatacttcttcaggattctccc
accaaaaccaatctcatcaacccctgctaccctcggaattatctcaccaccttcaccggg
ggctacatatttgacagcctgtgcacagcagacctgaggcctgtcagttacaaccctgaa
gacatcatcactgttggaggaaccggggacccatcgctgtgtagggaaaaggtggcttcc
ctgtttgatttcacagcttgccgtgaccaggaagcctgttcctttgatggggtctatcag
ccaaaagttaaagggacatttgtggcatttgctgggttctactacacagccagcgctttc
aatctctcagggagcttctccctcagtgccttcaactcaagcagctgggatttctgctca
gagagctggagccagctcccgctgctgctgcccaggtttgacgaggtgtatgcccgctcc
tactgcttctccgcccactatatctaccacttgctggtgaatggatacagattcaccgag
gagacctggccccaaatatattttaaaaaagaagtggggaacagcagcatagcctggtct
ttgggctacatgcttagcctgaccaaccagatcccagccgaaagccccctgatccgcctg
cccatggacccacctgcctttgtgggcaccctcgccttcttcacggcagtggccttgctg
tgtctggcgttcctcgtgtacctgtgcgcttcatctgggaagcagaggcgctcccagcat
gccttcgaccacacagtggattctgagtga

DBGET integrated database retrieval system