KEGG   Felis catus (domestic cat): 101085602
Entry
101085602         CDS       T02385                                 
Symbol
CSNK1A1
Name
(RefSeq) casein kinase I isoform X4
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101085602 (CSNK1A1)
   04340 Hedgehog signaling pathway
    101085602 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101085602 (CSNK1A1)
   05226 Gastric cancer
    101085602 (CSNK1A1)
   05224 Breast cancer
    101085602 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101085602 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085602 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    101085602 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101085602 (CSNK1A1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101085602 (CSNK1A1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101085602 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 Pox_ser-thr_kin APH Kdo
Other DBs
NCBI-GeneID: 101085602
NCBI-ProteinID: XP_003981453
Ensembl: ENSFCAG00000031849
UniProt: M3X447
LinkDB
Position
A1:199561548..199609462
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatttatctggcgatcaacattaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaaactctataagatccttcaaggtggggtgggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtgctagtcatggatcttcttggacccagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaat
ctcactggcaccgcccgatatgctagcatcaatgcacatctcggtattgagcagagtcgc
cgagatgacatggaatcattaggatatgttttgatgtattttaatagaaccagcctgccc
tggcaaggactaaaggctgcgacaaaaaagcaaaaatatgaaaagataagtgaaaagaag
atgtccactcctgttgaagttttatgtaaggggtttcctgcagaatttgccatgtactta
aactattgtcgtgggctgcgctttgaggaagccccggattacatgtatctgaggcagcta
ttccgcattcttttcaggactctgaaccaccagtatgactacacatttgattggacaatg
ttaaagcagaaagcagcacagcaggcagcctcttcaagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

DBGET integrated database retrieval system