KEGG   Felis catus (domestic cat): 101085820
Entry
101085820         CDS       T02385                                 
Symbol
ITGAV
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-V
  KO
K06487  integrin alpha V
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04514  Cell adhesion molecules
fca04810  Regulation of actin cytoskeleton
fca04919  Thyroid hormone signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101085820 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101085820 (ITGAV)
   04514 Cell adhesion molecules
    101085820 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101085820 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101085820 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101085820 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101085820 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085820 (ITGAV)
   05205 Proteoglycans in cancer
    101085820 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101085820 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101085820 (ITGAV)
   05165 Human papillomavirus infection
    101085820 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101085820 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    101085820 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101085820 (ITGAV)
   05414 Dilated cardiomyopathy
    101085820 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085820 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085820 (ITGAV)
   04515 Cell adhesion molecules [BR:fca04515]
    101085820 (ITGAV)
   04090 CD molecules [BR:fca04090]
    101085820 (ITGAV)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101085820 (ITGAV)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101085820 (ITGAV)
  Exosomal proteins of epithelial cells
   101085820 (ITGAV)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101085820 (ITGAV)
CD molecules [BR:fca04090]
 Proteins
  101085820 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 101085820
NCBI-ProteinID: XP_023115304
Ensembl: ENSFCAG00000005653
LinkDB
Position
C1:176487585..176581861
AA seq 1046 aa
MASPPRRRLRLRPRRLLLLLPGFLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHRGCQPIEFDATGNRDYAKDDPLEFKSH
QWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGAKTVEYAPCRSKNIDADG
QGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIQYNNQLATR
TAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQ
MAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRPSGDFQTTKL
NGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRLTGLNAVPSQIL
EGKWAARSMPPSFGYSMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYP
SILNQDNKTCPLPGTDLKVSCFNVKFCLKADGKGALPTKINFQVELLLDKLKQKGAIRRA
LFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITVFMEYRLDYRTAADV
TGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKA
QNQGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGT
QLLAGLRFNVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYKVDLAVLAAVEIRGVSSPD
HIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLYI
LQYDIDGPMNCTSDMEINPLRIKISSSQTEKNDTIAGQGDRSHLITKRDLTLSEGDVHTL
GCGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFP
YKNLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFK
RVRPPQEEQEREQLQPHENGEGNSET
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcggcggctgcgccttcgcccgcgccgcctcctgctccttctt
cccggattcctgctgcctctttgcggcgccttcaacctcgacgtggacagtcctgccgag
tactccggccccgaaggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcgatgtttcttctggtgggagcacccaaagcaaacactacccagcctgggattgtg
gaaggagggcaagtcctcaagtgtgactggtcttctcaccgcgggtgccagccaatcgaa
ttcgatgccacaggcaacagagattatgccaaggatgatccattggagtttaagtcccac
cagtggtttggagcatctgtgagatcaaaacaagataaaattttggcctgtgccccactg
taccactggaggactgaaatgaaacaggagagagagccagttggaacatgctttcttcag
gatggagcaaagactgtagagtatgctccatgcagatcaaaaaatattgatgctgatgga
cagggattttgtcaaggaggattcagcattgattttaccaaagctgacagagtacttctt
ggtggtcctggtagcttttattggcaaggtcagctcatttcggatcaagtggcagaaatt
gtatctaaatatgaccccaaagtttacagcatccagtataataaccagttggcaactcgg
actgctcaagctatttttgatgacagttacttgggttattccgtggctgtcggagatttc
aatggtgatggcatcgatgactttgtttcaggcgttccaagagcagcaaggactttggga
atggtttatatttatgatgggaaaaacatgtcctccttacacaattttactggtgagcag
atggctgcatattttggattttctgttgctgccactgacattaatggggatgattacgca
gatgtgtttattggagcccctctcttcatggatcgtggctcagatggcaaactccaagag
gtgggacaggtttcagtgtccctgcaaagaccttcaggagacttccagacgaccaagctg
aatgggtttgaggtctttgcgaggttcggcagtgccatagcacctttgggggatctggac
caggatggcttcaatgatattgccattgctgctccctatgggggcgaagataaaaaagga
attgtttatattttcaatggaagattaacaggcttgaatgcagtaccgtctcaaatcctt
gaagggaagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaaggagcc
acggatatagacagaaatggatatccagacttaattgtaggagcttttggtgtagataga
gctgtattatacagggccagaccagttataactgtaaatgctggccttgaagtgtaccct
agcatcttaaatcaagacaataaaacctgcccattgcctgggacagatctcaaagtttcc
tgttttaatgtcaagttctgcttaaaggcagatggcaaaggagcacttcccacgaaaatt
aatttccaggtggagcttcttttggataaactcaagcaaaaaggagcaattcgacgagca
ctatttctccataaccggtccccaggtcactccaagaacatgactatttcaaggggggga
cagatgcagtgtgaggaactaatagcatatctgcgggatgaatctgaatttagagacaaa
ctcactccgattactgtttttatggagtatcggttggattacagaacagctgctgatgtg
acaggcttgcaacctatccttaaccagttcactcctgccaacattagtcgacaggcccat
attttgcttgactgtggggaagacaatgtctgcaaacccaagttggaagtttctgtagat
agtgatcaaaagaagatctatattggagacgacaatcctctgacattgattgttaaggct
cagaatcaaggagaaggtgcctatgaagctgagctcatcgtttccatcccaccccaggct
gatttcatcggggttgtccgtaatagtgaagccttagctagactttcctgtgcatttaaa
acagaaaaccaaacccgccaggtggtatgtgaccttggaaacccaatgaaggctggaact
caactcctagctggtcttcgtttcaatgtacaccagcaatcagagatggatacttctgtg
aaatttgatttacaaatccaaagctccaatctctttgacaaagtaagcccagttgtatct
tacaaggttgacctcgctgtcttagctgctgttgagataagaggagtttcaagtcccgat
catatctttcttccaattccaaactgggagcataaggagaatccggagactgaagaagat
gttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattcagc
aaggcaatgctaaatcttcagtggccttacaaatataacaataacactctgttatacatc
cttcaatatgatattgatggacctatgaactgtacttcagatatggagatcaaccctttg
agaattaagatctcaagttcacaaactgaaaagaatgacacaattgctgggcaaggtgac
cggagccatctcatcactaagcgggatctcaccctcagtgaaggagatgttcacactttg
ggctgtggaattgctgagtgcttgaagattgtctgccaggttggacgactagacagaggg
aagagtgcaatcctgtatgtaaagtccctgctgtggactgagacctttatgaataaagaa
aaccagaatcattcatactctctgaagtcatctgcttcttttaatgtcattgagtttcct
tataagaaccttccaattgaggatatcttcaactccacattagttaccactaacgtcacg
tggggcattcagcccgcacccatgcccgtgcctgtgtgggtgatcattttagcagtgtta
gcaggattgctgttgctggctgttttggtgtttgtaatgtacaggatgggcttttttaaa
cgtgtccggccacctcaggaagagcaagaaagggaacagcttcaacctcatgaaaatggt
gaaggaaactcagaaacttaa

KEGG   Felis catus (domestic cat): 101092159
Entry
101092159         CDS       T02385                                 
Symbol
ITGB3
Name
(RefSeq) integrin beta-3 isoform X2
  KO
K06493  integrin beta 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04640  Hematopoietic cell lineage
fca04810  Regulation of actin cytoskeleton
fca04919  Thyroid hormone signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092159 (ITGB3)
   04151 PI3K-Akt signaling pathway
    101092159 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092159 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101092159 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092159 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092159 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101092159 (ITGB3)
   04611 Platelet activation
    101092159 (ITGB3)
   04613 Neutrophil extracellular trap formation
    101092159 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101092159 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101092159 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101092159 (ITGB3)
   05205 Proteoglycans in cancer
    101092159 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101092159 (ITGB3)
   05163 Human cytomegalovirus infection
    101092159 (ITGB3)
   05165 Human papillomavirus infection
    101092159 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101092159 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    101092159 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101092159 (ITGB3)
   05414 Dilated cardiomyopathy
    101092159 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092159 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101092159 (ITGB3)
   04515 Cell adhesion molecules [BR:fca04515]
    101092159 (ITGB3)
   04090 CD molecules [BR:fca04090]
    101092159 (ITGB3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101092159 (ITGB3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101092159 (ITGB3)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin beta subunits
   101092159 (ITGB3)
CD molecules [BR:fca04090]
 Proteins
  101092159 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 101092159
NCBI-ProteinID: XP_003997084
Ensembl: ENSFCAG00000003880
UniProt: A0A2I2ULN9
LinkDB
Position
E1:46436201..46491705
AA seq 784 aa
MRARPLWAAVLVLGALAGVGVGVSNICTTRGIHSCQECLAVSPACAWCSDEALPLGSPRC
NLKENLLKDNCALESVEFPVSEARILEARPLSDKGSGDSSQITQVSPQRIALRLRPDDSK
IFSVRVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPEALKNPCYDMKNTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSANSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEREKSFTIKPVGFKDSLTVQVTFDCDCACQAHAEPYSRRCNNGNGTFECG
VCRCGPGWLGSQCECSEEDYRPSQQEECSPQEGQPACSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGFYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCVCIQLGSYGDTCEKCPTCPDTCTFKKECVECKKFDRGDLRKENTCSRYCRDE
IESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcgagcgcggccgctctgggccgccgtgctggtgctgggggcgctggcgggcgtcggt
gtcggagtgtccaacatctgtaccacacgaggcatccactcctgccaggagtgtctggct
gtgagtcctgcgtgtgcctggtgctcagatgaggccctccctctgggctcgccccgctgt
aacctgaaagagaatctgctgaaggataactgtgcgttggagtccgtcgagttccccgtc
agtgaggcccgcatcttagaggccaggcccctcagcgacaagggctctggagacagctcc
cagattactcaagtcagcccccagaggattgcgctccggctccggccagatgattcgaag
attttctccgtccgagtccggcaggtggaggattaccctgtggacatctactacttgatg
gacctgtcttactccatgaaggatgatctatggagcatccagaacctgggcaccaagctg
gcctcccagatgcgcaagctcaccagtaacttgcggattggctttggggcttttgtggac
aagcctgtgtcaccatacatgtacatctcccctccagaggccctcaaaaacccctgctat
gatatgaagaacacctgcttgcctatgtttggctacaaacatgtgctgacactaactgac
caggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcgcggaaccgagatgcc
ccagagggtggctttgatgccatcatgcaggctacagtctgtgatgagaagattggctgg
aggaatgatgcctcccacttgctggtgtttaccactgatgccaagacccatattgcgctg
gatggaaggctggcaggcattgtccagcccaatgatgggcagtgccacgttggcagtgac
aaccattactctgcctccactaccatggattatccctctctggggctgatgaccgagaag
ctatcccagaaaaacatcaatttgatctttgctgtaacggaaaatgtagtcagtctctac
cagaactatagcgagctcatcccagggacgacagtgggggttctgtctgccaattccagc
aacgtccttcagctcattgttgatgcttatgggaaaatccgctctaaagtagagctggaa
gtgcgggacctccccgaggagctgtctctatccttcaacgccacctgtctcaacaacgag
gtcatccctggcctcaagtcttgtgtcggactcaagattggagacacggtgagcttcagc
attgaggccaaggtgcgaggctgcccgcaggagagggagaagtccttcaccatcaagcct
gtaggcttcaaagacagcctcaccgttcaggtcaccttcgactgtgactgtgcgtgccag
gcccatgctgagccttacagccgccgctgcaacaatggcaacgggacctttgagtgtggg
gtgtgccgctgcgggcccgggtggctggggtcccagtgcgagtgctccgaagaggactac
cgcccctcgcagcaggaagagtgcagcccccaggagggccagcccgcctgcagccagcgg
ggcgagtgcctgtgtggccagtgcgtctgccacagcagtgactttggcaagatcacgggc
aagtactgcgagtgtgatgacttctcctgcgtccgctataagggggagatgtgctcaggt
cacggccagtgcagctgtggggactgtctgtgtgactccgactggaccggcttctactgc
aactgcaccacgcgcaccgacacctgcatgtccagcaacgggctgctgtgcagcggccgg
ggcaagtgtgagtgcggcagctgcgtgtgcatccagctcggctcctacggggacacctgt
gagaagtgccccacctgccctgacacctgcacctttaagaaggagtgtgtggagtgtaag
aaatttgaccggggagacctacgtaaagaaaatacctgcagccgttactgtcgtgatgag
attgagtctgtgaaggagctcaaggatactggcaaggatgcagtgaactgcacgtacaag
aatgaagatgactgtgttgtcagattccagtactatgaagactccagtggaaagtccatt
ctctatgtggtagaggagccagagtgtcccaagggtcctgacatcctggtggtcctactc
tcagtgatgggggccattttgctcatcggccttgctactctgctcatctggaagctcctc
atcaccatccatgaccggaaggagtttgctaaatttgaggaagagcgagccagagcaaaa
tgggacacagccaacaacccactgtataaagaggccacatccaccttcaccaacatcacc
taccggggcacttaa

DBGET integrated database retrieval system