KEGG   Felis catus (domestic cat): 101085953
Entry
101085953         CDS       T02385                                 
Symbol
CD74
Name
(RefSeq) HLA class II histocompatibility antigen gamma chain isoform X1
  KO
K06505  CD74 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101085953 (CD74)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101085953 (CD74)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101085953 (CD74)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101085953 (CD74)
   00535 Proteoglycans [BR:fca00535]
    101085953 (CD74)
CD molecules [BR:fca04090]
 Proteins
  101085953 (CD74)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Others
   101085953 (CD74)
SSDB
Motif
Pfam: MHC2-interact MHCassoc_trimer Thyroglobulin_1
Other DBs
NCBI-GeneID: 101085953
NCBI-ProteinID: XP_003981534
Ensembl: ENSFCAG00000002036
LinkDB
Position
A1:198782925..198813464
AA seq 334 aa
MGGVASCGRIRFLLSPDFKRWATGSGSQTPRRQQQQQQQQQQQEVWWGRLEARTMEDQRD
LISNHEQLPILGQRPAAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQGRLDKLT
VTAQNLQLENLRMKLPKPAKPLNKLRVATPMLMQTMPVRGLLQAPMQNATKYGNMTQDHV
MHMLLEGDPLKVYPQLKGNFPENLKHLKNTMGTLDWKVFENWMYQWLLFEMSKNSLEKHP
ADIPLKVLTKCQEEVSRIPAVHPGTFRPQCDENGNYKPLQCYGSTGYCWCVFPNGTEVPH
SRSHGHRNCSESVDVEDLSSGLGMTKPDLGQVVM
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggcggagtggcctcctgtggacgaatcagattcctcctcagccccgacttcaagagg
tgggccacgggttcagggtcccagacaccgaggaggcagcagcagcagcagcagcagcag
cagcagcaggaggtgtggtggggaagactagaggccagaaccatggaagaccagcgcgac
cttatctccaaccatgagcagctgcccattctgggccagcgtcctgcagccccggagagc
aagtgcagccgaggagccctgtacacaggcttttctgtcctggtggctctgcttctggcc
ggccaggccaccactgcctacttcctgtaccagcagcagggccggctggacaagctgacg
gtcaccgcacagaacctgcagctggagaacctgcgcatgaagcttcccaagcctgccaag
cctttgaacaagttgcgggtagccacccccatgctgatgcagacgatgcccgtgcgaggc
ctgctccaggcgcccatgcagaacgccaccaagtacggcaacatgacacaggaccacgtg
atgcacatgctcctggagggtgaccctctgaaggtgtacccgcagctgaaggggaacttc
ccggagaacctgaaacaccttaagaacaccatggggaccctggattggaaggtcttcgag
aactggatgtatcagtggctcttgtttgaaatgagcaagaactccctggagaagcacccc
gccgacattccactgaaagtactgaccaagtgccaggaagaggtcagccgcattcccgcc
gtccaccctggcacgttcaggccccagtgcgacgagaacggcaactataagccgctccag
tgctatgggagcaccggctactgctggtgcgtcttccccaacggcaccgaggtcccccac
agcaggagccacgggcaccgtaactgcagtgagtcagtggacgttgaagacctgtcatct
gggctgggcatgaccaagccggacctgggccaagtggtcatgtga

DBGET integrated database retrieval system