KEGG   Felis catus (domestic cat): 101086264
Entry
101086264         CDS       T02385                                 
Symbol
VAV2
Name
(RefSeq) guanine nucleotide exchange factor VAV2 isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05205  Proteoglycans in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101086264 (VAV2)
   04024 cAMP signaling pathway
    101086264 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101086264 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101086264 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101086264 (VAV2)
   04660 T cell receptor signaling pathway
    101086264 (VAV2)
   04662 B cell receptor signaling pathway
    101086264 (VAV2)
   04664 Fc epsilon RI signaling pathway
    101086264 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    101086264 (VAV2)
   04670 Leukocyte transendothelial migration
    101086264 (VAV2)
   04062 Chemokine signaling pathway
    101086264 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101086264 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101086264 (VAV2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101086264 (VAV2)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 SH2_2 PH_10 zf-RING_16 C1_2
Other DBs
NCBI-GeneID: 101086264
NCBI-ProteinID: XP_023098740
LinkDB
Position
D4:93791031..93960170
AA seq 878 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHHV
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMIRYMQKMGMSEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMAPLRPVLSPADMTAI
FINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLK
EALEAMQDLAMYINEVKRDKETLKKISEFQSCIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRRGYSYELKEVIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
RMFLRGTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDASGAGPGPKMVAVQNYHGN
PAPPGKPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVSR
PPSREIDYTEYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERAASRASSR
SPASCASYNFSFLSPQGLSFASQGSSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DLVKIYSRIGGDQGWWKGEANGRIGWFPSTYVEEEGIQ
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgggtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggc
gtcctcctgtgccagctgctgcacaacctgtcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagttcctgtgtttaaagaacatccgcaccttcctgaaa
gtctgccacgataaatttggactacgaaacagcgagctgtttgaccccttcgacctcttc
gatgtccgagactttgggaaggtcatctctgccgtgtccagactctccctgcaccacgtg
gctcagaacaaagggatcaggccctttccctcggaggagaccgcggaaaacgacgatgat
gtctatcgcagcctggaggagctggccgacgagcatgacctgggggaagacatctatgac
tgtgtcccgtgcgaagatgagggcgacgacatctacgaggacatcatcaaggtggaggta
cagcagcccatgatcagatacatgcagaagatgggcatgtccgaggacgacaagagaaac
tgctgcctgctggagattcaggagaccgaggccaagtactaccggaccctggaggacatt
gagaagaactacatggccccgctgaggccggtgctgagcccggcggacatgacggccatc
ttcatcaacctggaggacctaatcaaagtgcatcacagcttcctgcgggccattgacgtg
tccatgatggcagggggcagcactctggccaaggtcttcctggacttcaaggagaggctc
ctgatctacggggaatattgcagccacatggagcacgcccagaacacgctgaaccagctc
ctcgccagccgggaggacttccgacagaaggtcgaggaatgcactctgaaggtccaggac
gggaagtttaagcttcaggacctgctcgtggtccccatgcagagggtgctcaagtatcac
ctgctcctgaaggaactcctgagccactccgcggatcggcccgagaggcagcagctcaaa
gaggcactggaagccatgcaggacttggcgatgtacataaacgaagttaagcgggacaag
gagaccctgaagaaaatcagtgaatttcagagttgtatagaaaacttgcaggtgaaactg
gaggagttcgggaggccgaagattgacggggaactgaaggtccggtccatagtcaaccac
acgaagcaagataggtacttgttcctgtttgacaaggtggtcatcgtctgcaagaggagg
ggctacagctatgagctgaaggaggtcatcgagctgctcttccacaagatgaccgacgac
cccatgaacaacaaggacgtcaagaagtctcatgggaaaatgtggtcctacggcttctat
ctaatccacctccaaggaaagcagggcttccagtttttctgcaagacagaggacatgaag
cggaaatggatggaacagtttgagatggccatgtcaaacatcaagccagacaaagccaat
gccaaccaccacagcttccagatgtacacttttgacaagaccaccaactgcaaagcctgc
aggatgttcctcaggggtaccttctaccagggctacctgtgcaccaagtgtggtgtcggg
gcacacaaggaatgtctggaagtgacccctccctgcaagatcagttctcctgcagacctg
gacgcctctggagcaggaccgggtcccaagatggtggccgtgcagaattaccatggcaac
cctgctccccctgggaagccagtgctgaccttccagacgggtgatgtgatcgagctgctg
aggggcgaccccgagtctcaatggtgggagggtcggctggtgcagaccagaaagtcaggc
tactttcctagctcgtccgtgaagccctgccccgtggatggaaggccgcccgtcagccga
ccgccctcccgggagatcgactacacggaatacccctggttcgcaggcaacatggagaga
cagcagacagacaacctgctgaaatcgcacgccagtgggacctacctgatcagggagcgg
ccagccgaggcggagcgctttgccataagcatcaagttcaacgatgaagtgaagcacatc
aaggtggtcgagaaagacagctggatccacattacagaagcgaagaagtttgaaagcctc
ttggagctggtggagtactatcagtgccactcgctcaaggagagcttcaagcaactggac
accacgctcaagtacccctacaagtcacgggagcgcgcggcctccagggcctccagccgg
tccccagcttcctgcgcctcctacaacttttcttttctcagtcctcagggcctcagcttt
gcctcccagggctcctccgctcccttctggtcagtgttcacaccccgcgtcatcggcacg
gccgtggccaggtacaactttgctgcccgggatatgcgtgagctctcactgcgggaaggc
gacctggtgaagatatatagccgcattggcggggaccagggctggtggaagggcgaggcc
aacggacggatcggctggtttccttcaacatatgtggaagaggagggcatccagtga

KEGG   Felis catus (domestic cat): 101087417
Entry
101087417         CDS       T02385                                 
Symbol
VAV3
Name
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05205  Proteoglycans in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101087417 (VAV3)
   04024 cAMP signaling pathway
    101087417 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101087417 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087417 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101087417 (VAV3)
   04660 T cell receptor signaling pathway
    101087417 (VAV3)
   04662 B cell receptor signaling pathway
    101087417 (VAV3)
   04664 Fc epsilon RI signaling pathway
    101087417 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    101087417 (VAV3)
   04670 Leukocyte transendothelial migration
    101087417 (VAV3)
   04062 Chemokine signaling pathway
    101087417 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101087417 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101087417 (VAV3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101087417 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_9 SH3_1 SH2 C1_1 PH CDC24 Filamin PH_10 LZ3wCH Prok-RING_1 C1_2 zf-RING_16 zf-RING-like
Other DBs
NCBI-GeneID: 101087417
NCBI-ProteinID: XP_011283337
Ensembl: ENSFCAG00000001191
UniProt: M3VW63
LinkDB
Position
C1:complement(92161698..92516317)
AA seq 847 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEDIYKGLPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EAHQAKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVELAISSLDNISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPMEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFSRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSAEQGTLKPPEKRTNGLRRNPRQVDPGLPKMQVI
KNYTGTPPPALHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GHSLLSPKVLGIAVARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccctggaagcagtgcgcgcagtggctcatccactgcaaggtgctgccggccaac
caccgggtgacctgggactcggcgcaggtgtttgacctggcgcagacccttcgcgatgga
gtcctgctctgccagctgctcaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggcctcagatgtcccagtttctctgtttgaagaacataaggacattcctcacg
gcctgttgcgagacatttggaatgagaaagagtgaactctttgaagcatttgacctgttt
gatgttcgtgactttggaaaggttatagaaacactgtcacgactttctcgcacacctata
gcgttggccacaggaatcaggcccttcccaacagaagaaagtgttaatgatgaagacatt
tacaaaggccttcctgatttaatagatgaaacccatgtggaagatgaagaaggtctctac
gactgtgtttatggggaagacgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcaagccaaatgtccagaaaatgacatacgaagttgctgcctagcagaaatt
aagcagacagaagaaaaatacacagaaacgttggagtcaatagaaaaatatttcatggca
ccgctaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaagttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccaaaacttgtatcaagttttcattaactacaaggaaaggttggttatatatgggcag
tactgtagtggagtggagttggccatctctagtttagacaacatttctaagacaaaagaa
gatgtaaaactgaaattagaggaatgttccaaaagagcaaataatggaaaattcactctt
cgagatttgcttgtggttcctatgcaacgggttttaaagtatcaccttcttctccaggaa
ctggtcaaacataccactgatcctatggagaaggcaaatctgaaactggctcttgatgcg
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagaaaatctgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgcataaccactctagacaagcatacaaagcaagaaagg
catatcttcctgtttgatttggcagtgattgtatgtaaaaggaaaggcgataactatgaa
atgaaggaaataatagatcttcagcagtacaaaatagccaacaatcctacaactgataaa
gaaaataaaaagtggtcttacggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaaaaaatggctggaacagtttgaaatggct
ttatcgaacataaggccagactacgcagactccaatttccatgagttcaagatgcacacc
ttcagtcgggttacatcctgcaaagtctgccagatgctcctgagaggaacattttatcaa
ggctatttatgttttaaatgtggcgcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctgctgaacaagggacgctcaaaccaccggagaaacggacc
aatggactacgaagaaacccgagacaggtggatccaggtttaccaaagatgcaggtcatc
aagaactatactgggacaccacccccggctcttcatgaaggacccccgttacatatccag
gcaggggatacggttgaacttctgagaggagacgcacacagtctgttttggcagggtaga
aatttagcatctggagaggttggattttttccaagtgatgctgtcaagccttgcccctgt
gtccccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caggcagagactgaacttattaatagggtaaatagtacttaccttgtgagacacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctcttaaagaaggttttagaaccttggatacg
accctacagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggccacagcttgctaagtccaaaagtgctgggcatcgccgttgctcggtatgacttctgt
gccagagacatgcgagaattgtccttgctgaaaggagacgtggtgaagatttacacgaag
atgagtgcaaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acgtatgtggaagaggatgaataa

KEGG   Felis catus (domestic cat): 101097212
Entry
101097212         CDS       T02385                                 
Symbol
VAV1
Name
(RefSeq) proto-oncogene vav isoform X3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05205  Proteoglycans in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101097212 (VAV1)
   04024 cAMP signaling pathway
    101097212 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097212 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101097212 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101097212 (VAV1)
   04660 T cell receptor signaling pathway
    101097212 (VAV1)
   04662 B cell receptor signaling pathway
    101097212 (VAV1)
   04664 Fc epsilon RI signaling pathway
    101097212 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    101097212 (VAV1)
   04670 Leukocyte transendothelial migration
    101097212 (VAV1)
   04062 Chemokine signaling pathway
    101097212 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101097212 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101097212 (VAV1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101097212 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 LZ3wCH
Other DBs
NCBI-GeneID: 101097212
NCBI-ProteinID: XP_003981777
Ensembl: ENSFCAG00000005052
UniProt: M3W3D5
LinkDB
Position
A2:5120518..5169076
AA seq 846 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEETVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
AEPVPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDIEIIFIN
IEDLLRVHTLFLKEMKEVLGTPGAPTLYQVFIKYKERFLVYGRYCSQVESASKHLDHVAA
AREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDVMEKENLRQA
LDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSK
MDRYAFLLDKALLICKRRGDSYDLKNVVDLQSFQVRDDSSGERENKKWTHMFLLIEDQGS
QGYELFFKTRELKKKWLEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGT
FYQGYRCHRCRAPAHKECLGRVPPCGRHGQDFSGTMKKDKPHRRPQDKKRNDLGLPKMEV
CQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYV
HGPPQDLTVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDSAEFAISIKYNVEVKHIK
IMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTCLQFPFKEPERRAISKPPAG
STKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPSNYVEE
DYSEYC
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggagctgtggcgccagtgcacccactggctgatccagtgccgggtgctgccccccagc
caccgcgtgacctgggatggggcccaggtgtgcgagctggcacaggccctgcgggatggc
gtccttctgtgccagctgctcaacaacctgctgccccacgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtctcagttcctgtgccttaagaacatacgtaccttcttgtct
acctgctgtgagaagtttggcctcaagcggagtgaactctttgaggcctttgacctcttt
gatgtccaggattttgggaaggtcatctacaccctgtctgctctgtcctggaccccgatt
gcccagaataaggggatcatgcccttccccactgaggaggagaccgtgggtgatgaagac
atctacagtggcctgtctgaccagatcgacgacacggtggaagaggatgaggacctgtat
gactgtgtggagaacgaggaggcggagggtgatgagatctacgaagacctcatgcgctcc
gcggagccggtgcccatgccgcccaagatgacagagtatgacaagcggtgttgctgcctg
cgggagatccagcagacggaggagaagtacacggacacgctgggatccatccaacagcat
ttcatgaagcccctgcaacggttcctcaaaccccaagacattgagattatcttcatcaac
atcgaggacctgcttcgtgtgcacactctcttcctaaaggagatgaaggaagtcctgggc
accccaggtgcgcccaccctctaccaggtgttcatcaaatacaaggagaggttcctcgtc
tacggccgctactgcagccaggtggagtcagccagcaagcacctggaccatgtggccgcc
gcccgggaggatgtgcaaatgaagctggaggaatgttctcagcgagcaaacaacgggagg
ttcaccttgcgggacctgctgatggtgcccatgcagcgggtgctcaagtatcacctcctt
ctccaggagctggtcaaacacacgcaggacgtgatggagaaggagaacttgaggcaggcc
ctggacgccatgagggacctggcacagtgtgtgaatgaggtcaagcgggacaacgagacg
ttacggcagatcaccaatttccaactgtccatcgagaacctggaccagtctctggcccac
tatggccggcccaagatcgatggggagctcaagatcacctcagtggagaggcgctccaag
atggaccggtacgccttcctgctcgacaaagctctgctcatctgcaagcgccgaggggac
tcctacgacctcaagaatgttgtggatctgcaaagcttccaggttcgagatgattcctct
ggagagcgagaaaacaagaagtggactcacatgtttctcctgatcgaggaccaaggttcc
cagggctatgagctgttctttaagacgcgagaactgaagaagaagtggctggagcagttc
gagatggccatctccaacatctaccctgagaacgctactgccaacgggcacgacttccaa
atgttctcctttgaggagaccacgtcgtgcaaggcttgccagatgctgctgagaggcact
ttctatcagggttaccgttgtcatcggtgccgggcacctgcacacaaggagtgtctggga
agggtccctccatgtggccgacatgggcaagatttttcaggaactatgaagaaggataag
ccacatcgccgacctcaggacaaaaagcggaatgacctgggcctgcccaagatggaggtg
tgccaggaatactatgggcttcccccaccacctggagccattggtcctttcctgcggctc
aaccctggagacatcgtggagctcaccaaggctgaggccgaacagaactggtgggagggc
aggaatacggctaccaatgaagttggctggtttccctgtaacagggtcaagccctacgtg
catggtccccctcaggacctgactgttcatctctggtacgctggccccatggagcgcgcc
ggggcagaaagtatcctcaccaaccgctcggatgggacgttcttggtgcggcagcgggtg
aaggactcagcagaatttgccatcagcattaagtataatgttgaggtcaaacacattaaa
atcatgacagcagaaggattgtaccggattacagagaagaaggctttccgggggcttacg
gagctggtggaattttaccagcagaattccctgaaggactgcttcaagtctctggacacc
tgcctgcagttccccttcaaggagcctgagaggagagccatcagcaaaccaccagcagga
agcacgaagtattttggtacagccaaagcacgctatgacttctgtgcccgggaccgatca
gagctgtccctcaaggagggtgacatcatcaagatccttaacaagaaaggtcaacaaggc
tggtggcgaggggagatctatggccgggttggctggttcccctccaactacgtggaggaa
gattactctgaatactgctga

DBGET integrated database retrieval system