KEGG   Felis catus (domestic cat): 101086275
Entry
101086275         CDS       T02385                                 
Symbol
CCL24
Name
(RefSeq) C-C motif chemokine 24
  KO
K21097  C-C motif chemokine 24
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086275 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086275 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086275 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086275 (CCL24)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086275 (CCL24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086275
NCBI-ProteinID: XP_003998596
Ensembl: ENSFCAG00000023127
UniProt: M3WYH2
LinkDB
Position
E3:9691595..9694105
AA seq 119 aa
MAGLATMVASLLLLALCAHRIAPAGSVTIPSSCCMSFISKKVPESRVVSYQLSSGSLCPK
AGVIFTTRKGQKFCGDPEQHWVQTYVKNLDAKRKKAATGLRATGVKALPQRSPASSTAI
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcaggccttgcaaccatggtggccagcctcctgctgctggccctgtgtgcccaccgc
attgcccctgcaggctctgtgaccatcccctcttcctgctgtatgtccttcatttccaag
aaagttccagagagccgagtggttagctaccagctgtccagtgggagcctctgccccaag
gcaggagtgatcttcaccacccggaagggccagaagttctgtggcgaccctgagcagcac
tgggtccagacgtacgtgaagaacctggacgccaagcggaagaaggcggccacggggctc
agggcgacgggtgtcaaagccctcccgcagaggtcccctgccagtagcactgccatctaa

KEGG   Felis catus (domestic cat): 101086511
Entry
101086511         CDS       T02385                                 
Symbol
CCL27
Name
(RefSeq) C-C motif chemokine 27
  KO
K16598  C-C motif chemokine 27
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086511 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086511 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086511 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086511 (CCL27)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086511 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086511
NCBI-ProteinID: XP_003995634
LinkDB
Position
D4:complement(58473760..58474643)
AA seq 115 aa
MKGPSPTSSLLLLLLLLTPDPGAALLLSPSITCCTQLYRQPLSNKLLRKVIRVELQEADG
DCHLQAFVLHLSRRSVCIHPQNRSLARWFERQGRRFQGILPNLNLELIGKMDQGP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaggggccctcacccacaagcagcctccttctgctactgctgctgctgaccccagac
cctggagcagcactgctactgtcacccagcattacctgctgtactcagctctaccgccag
ccactctcgaacaagctactaaggaaagtcatccgggtggaactgcaggaagctgatggg
gactgtcacctccaggccttcgtgcttcacttgtctcgacgcagtgtctgcatccatcct
cagaaccgcagcctggctcggtggtttgagcgccaagggaggagattccagggtattctg
cctaacctgaatttggaactgatagggaaaatggaccaggggccctaa

KEGG   Felis catus (domestic cat): 101086516
Entry
101086516         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 23
  KO
K05511  C-C motif chemokine 15/23
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086516
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086516
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086516
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086516
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086516
NCBI-ProteinID: XP_003996646
LinkDB
Position
E1:complement(23334164..23338260)
AA seq 107 aa
MKVFAAALPFLIVATAFGAQVQALHEPMVAIRPHETSIHLQGFHRPSDCCTRYTPRKIRC
GLMEDYYETSSGCSQPGVIFLTKKGQRVCANPFDLGVQNCVRSLKSN
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaaggtcttcgcagctgccctccccttcctcattgttgctactgcctttggagcccag
gtccaggcccttcatgaacccatggtggcaatacgtccgcatgaaacctcgatacatctg
caaggctttcaccgtccctctgactgctgcacccgctacactccacggaaaatccgatgt
ggactcatggaagattactatgaaacaagcagcgggtgctcccagccaggtgtcatcttc
ctcaccaagaaggggcagcgtgtctgtgccaacccctttgatttgggagttcagaattgc
gtgaggtccctgaagtcgaactaa

KEGG   Felis catus (domestic cat): 101086525
Entry
101086525         CDS       T02385                                 
Symbol
CCL26
Name
(RefSeq) C-C motif chemokine 26
  KO
K21096  C-C motif chemokine 26
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086525 (CCL26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086525 (CCL26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086525 (CCL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086525 (CCL26)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086525 (CCL26)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086525
NCBI-ProteinID: XP_023102628
LinkDB
Position
E3:9705773..9708715
AA seq 94 aa
MKSLPVGFLVLLIFILSVHLGAATRGSNVAKFCCFQYSHKILPWKWVHAYKFTRNSCSQR
AVIFVTKKGHKVCAQPKEKWVQRYISLLRAQQQM
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagagccttcctgttggctttcttgttctcctgatcttcatcctgagtgtccatctc
ggagctgccacacgtggcagcaatgtggccaagttctgctgcttccaatatagccacaag
atccttccttggaagtgggtgcatgcctataaattcaccaggaacagctgctcccagcgg
gctgtgatattcgttaccaaaaaaggccataaagtctgtgcacagccaaaggaaaaatgg
gtgcaaagatacatttctttactcagagcacagcagcaaatgtga

KEGG   Felis catus (domestic cat): 101091759
Entry
101091759         CDS       T02385                                 
Symbol
CCL28
Name
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091759 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101091759 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101091759 (CCL28)
   04062 Chemokine signaling pathway
    101091759 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101091759 (CCL28)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101091759 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101091759
NCBI-ProteinID: XP_019667124
LinkDB
Position
A1:206943445..206969546
AA seq 279 aa
MGATNLFFDFSPALRRAAAGSPSRSWVLRASVRAAQARPQDAGGGGWSRQWPGEVPGDAE
QANAFGCPWPLPWAWSLFSSGRFSANVLLGAARTTHGLTEKPPGLASGAKSAAHAQRQEE
RRVVAPVCHNRHHPLLAAAALPPPSRPWARDPVPAPRLWLSASPASWPPRPQTPILPIAS
SCCTEVSRHVSRRLLERVNICRIQRADGDCDLAAVILHIRRRRVCVSPHSHIIKQWMKEQ
EAKKKAKGNLCHKKKQDGKRNSKGAHQGKPETHGYKTPY
NT seq 840 nt   +upstreamnt  +downstreamnt
atgggggccaccaacctgttcttcgatttctctccagctctacgaagggcagcggccggt
agcccaagccggagctgggtgctccgggcctcagtccgcgccgcccaagcgcggcctcag
gacgctgggggcggaggctggagtcgccagtggcctggggaggtcccaggcgacgccgag
caggctaacgctttcgggtgcccgtggcccctcccctgggcgtggtccttattctcctcc
ggccgcttctccgcgaacgtcctcctcggcgccgcgcgcaccacccacgggctaacagaa
aagccgccgggcctcgccagtggcgccaagtccgctgcgcacgcgcagaggcaggaggag
cggcgggttgtggctccggtatgtcacaacaggcaccacccgcttcttgctgcagccgct
ctccctcctccttctcgtccttgggctcgggatccggttccagcaccaaggctctggctc
tcggcctctcctgcttcatggccgccacgacctcagacacccatacttcccattgcctcc
agctgttgcactgaggtttcacgtcatgtttccagaaggcttctggagagagtgaatata
tgtcgcattcagagagctgatggggattgtgacttggctgctgtcatccttcacatcagg
cgcaggagggtctgcgtcagcccgcacagtcacattattaagcagtggatgaaagaacaa
gaggccaagaaaaaagctaaaggcaacctttgccacaagaagaaacaggacggcaagagg
aacagcaaaggggcacatcaggggaaacccgaaacccatggctataaaactccttattaa

KEGG   Felis catus (domestic cat): 101096931
Entry
101096931         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 7
  KO
K05509  C-C motif chemokine 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096931
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096931
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101096931
   04062 Chemokine signaling pathway
    101096931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096931
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101096931
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101096931
NCBI-ProteinID: XP_003996606
Ensembl: ENSFCAG00000013588
UniProt: A0A337RX34
LinkDB
Position
E1:22096953..22098794
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQALAQPEGINSPTTCCYRFTVRKIPIQKLKSYRRITSSYCP
REAVIFKTKQAKELCADPKQKWVQDFMEYLDKKTQTSKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag
gcacttgctcagccagagggaattaatagcccaaccacctgctgctatagatttaccgtt
agaaagatccccatccagaagctgaagagctacagaagaatcaccagcagctattgtccc
agggaagccgtgatcttcaagaccaaacaggccaaggagctctgtgctgaccccaagcag
aagtgggtccaggatttcatggagtacctggacaagaaaacccaaacctcaaagctatga

KEGG   Felis catus (domestic cat): 101099760
Entry
101099760         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 13
  KO
K16595  C-C motif chemokine 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101099760
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099760
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099760
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101099760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101099760
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101099760
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101099760
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101099760
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101099760
NCBI-ProteinID: XP_003996618
Ensembl: ENSFCAG00000026454
UniProt: M3X6S8
LinkDB
Position
E1:22145112..22146597
AA seq 98 aa
MRVSAALLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ
TAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag
gcgctcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacatttaacaat
aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag
acagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa
tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

KEGG   Felis catus (domestic cat): 109493846
Entry
109493846         CDS       T02385                                 
Name
(RefSeq) uncharacterized protein LOC109493846
  KO
K16598  C-C motif chemokine 27
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109493846
   04061 Viral protein interaction with cytokine and cytokine receptor
    109493846
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    109493846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    109493846
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   109493846
SSDB
Other DBs
NCBI-GeneID: 109493846
NCBI-ProteinID: XP_019671693
UniProt: M3WPK2
LinkDB
Position
D4:complement(58477329..58479467)
AA seq 87 aa
MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRDRSSAHPREQKLEPLRGLMSCLSSGLG
PAPQRSGRGLPRRTPAATAQPAGALKI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtcgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggt
tgcttctactttttcccctggctgcgcatgtggcggagggacaggagctcggcgcatccg
cgggagcagaagttggagcctctgcgaggcctgatgagctgtctgtcaagcggactgggc
cctgccccccagcgctcgggtcgcggcctccctcgccgcacccccgccgccactgcccag
ccagccggtgcattaaagatttaa

KEGG   Felis catus (domestic cat): 493689
Entry
493689            CDS       T02385                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine 5 precursor
  KO
K12499  C-C motif chemokine 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04668  TNF signaling pathway
fca05020  Prion disease
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    493689 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493689 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493689 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493689 (CCL5)
   04621 NOD-like receptor signaling pathway
    493689 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    493689 (CCL5)
   04062 Chemokine signaling pathway
    493689 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    493689 (CCL5)
   05168 Herpes simplex virus 1 infection
    493689 (CCL5)
   05163 Human cytomegalovirus infection
    493689 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493689 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493689 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    493689 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493689 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493689 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493689 (CCL5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493689 (CCL5)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   493689 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 493689
NCBI-ProteinID: NP_001009827
Ensembl: ENSFCAG00000001259
UniProt: Q8SQ40
LinkDB
Position
E1:complement(23276060..23282999)
AA seq 92 aa
MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP
AVVFVTRRKRQVCANPQKKWVRDKGINSLEMN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccacagctgcctttgcagtcctcctcactgctgccgctttctgcactcct
gcctctgcatccccatatgcctcggacaccaccccctgctgctttgcctacctctcccac
ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca
gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg
gtgcgggacaagggcatcaactctttggagatgaactag

DBGET integrated database retrieval system