KEGG   Felis catus (domestic cat): 101086432
Entry
101086432         CDS       T02385                                 
Symbol
MAP2K4
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04912  GnRH signaling pathway
fca04926  Relaxin signaling pathway
fca04935  Growth hormone synthesis, secretion and action
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05142  Chagas disease
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086432 (MAP2K4)
   04012 ErbB signaling pathway
    101086432 (MAP2K4)
   04668 TNF signaling pathway
    101086432 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101086432 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    101086432 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101086432 (MAP2K4)
   04926 Relaxin signaling pathway
    101086432 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    101086432 (MAP2K4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101086432 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086432 (MAP2K4)
   05161 Hepatitis B
    101086432 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086432 (MAP2K4)
   05169 Epstein-Barr virus infection
    101086432 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101086432 (MAP2K4)
   05135 Yersinia infection
    101086432 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101086432 (MAP2K4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101086432 (MAP2K4)
   05418 Fluid shear stress and atherosclerosis
    101086432 (MAP2K4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101086432 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086432 (MAP2K4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101086432 (MAP2K4)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101086432 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal ABC1 Haspin_kinase APH
Other DBs
NCBI-GeneID: 101086432
NCBI-ProteinID: XP_023100225
Ensembl: ENSFCAG00000011997
LinkDB
Position
E1:6111737..6254038
AA seq 411 aa
MAAPSPSGGGGGSGGGSGSGTPGPVGPPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNF
ANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
GRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGAL
FREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHR
DIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRS
DVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCL
TKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggcggctccgggggcggcagcggcagcggc
accccgggccccgtggggcccccggcgccgggccacccggccgtcagcagcatgcagggc
tttcagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaatttt
gcaaatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagtt
caaaacccacacatagagaggctgagaacacacagcatcgaatcgtcgggaaaactgaag
atctctcctgagcagcactgggatttcaccgcggaggacttgaaggaccttggagaaatt
ggacgaggagcttacggttccgtcaacaaaatggtccacaaaccaagtgggcagataatg
gcagttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggat
ttggatgtagtaatgcgcagtagtgactgcccgtacattgttcagttttatggtgcactc
ttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttt
tacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatc
actttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcacaga
gatatcaaaccttccaatattcttctggacaggagtgggaatattaagctctgtgacttt
ggcatcagtggacagctggtggactccattgccaagacaagagatgccgggtgtaggcca
tacatggcacctgaaagaatagacccaagtgcatctcgacaaggatatgatgtccgctct
gatgtctggagtttggggatcacattgtacgagttagccacaggccgatttccttaccca
aagtggaatagtgtattcgatcaactaacacaagtcgtgaaaggagaccctccacagctg
agtaactcggaggaaagggagttctcccccagtttcatcaactttgtcaacttgtgcctt
acgaaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttg
atgtatgaagaacgtaccgtagaggtcgcatgctacgtttgtaaaatcctggatcaaatg
ccagccactcccagctcccccatgtacgtcgactga

KEGG   Felis catus (domestic cat): 101095157
Entry
101095157         CDS       T02385                                 
Symbol
MAP2K7
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04380  Osteoclast differentiation
fca04530  Tight junction
fca04620  Toll-like receptor signaling pathway
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04912  GnRH signaling pathway
fca04926  Relaxin signaling pathway
fca04936  Alcoholic liver disease
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05161  Hepatitis B
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101095157 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101095157 (MAP2K7)
   04012 ErbB signaling pathway
    101095157 (MAP2K7)
   04668 TNF signaling pathway
    101095157 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101095157 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101095157 (MAP2K7)
   04660 T cell receptor signaling pathway
    101095157 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    101095157 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101095157 (MAP2K7)
   04926 Relaxin signaling pathway
    101095157 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101095157 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101095157 (MAP2K7)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101095157 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101095157 (MAP2K7)
   05161 Hepatitis B
    101095157 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095157 (MAP2K7)
   05169 Epstein-Barr virus infection
    101095157 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095157 (MAP2K7)
   05135 Yersinia infection
    101095157 (MAP2K7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095157 (MAP2K7)
   05016 Huntington disease
    101095157 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    101095157 (MAP2K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095157 (MAP2K7)
   05418 Fluid shear stress and atherosclerosis
    101095157 (MAP2K7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101095157 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095157 (MAP2K7)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101095157 (MAP2K7)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101095157 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Seadorna_VP7 Haspin_kinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101095157
NCBI-ProteinID: XP_011287045
Ensembl: ENSFCAG00000014944
UniProt: A0A337SEU0
LinkDB
Position
A2:complement(5995106..6004702)
AA seq 435 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEIHDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRVQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYEMLEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgcgaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccgctggccaatgatgggggcagccgctcaccgtcctccgagagctccccacagcac
cccacaccccctgcccggccccgccacatgctggggcttccgtcaaccttgttcacaccc
cgcagcatggagagcatcgaaattgaccagaagctacaggagatcatgaagcagacgggc
tacctaaccatcgggggccagcggtaccaggcagaaatccacgatctggagaacctgggc
gagatgggcagcggcacttgcggccaggtgtggaagatgcgcttcaggaagacgggccat
gtcattgccgtcaagcaaatgcggcgctcggggaacaaggaggagaacaagcggatcctc
atggacctggatgtggtcctcaagagccatgactgcccctacatcgtgcagtgcttcggg
accttcatcactaatacggatgttttcatcgccatggagctcatgggcacgtgcgccgag
aagctcaagaagcgggtgcagggccccattcccgagcggatcctgggcaagatgacggtg
gcgatcgtgaaggcgctgtactacctgaaggagaagcacggcgtgatccaccgtgacgtc
aagccctccaacatcctgctggacgagcggggccagatcaagctctgcgacttcggcatc
agcggccgtctcgtcgattccaaggccaagacgcgcagcgcgggctgtgccgcctacatg
gcacctgagcgcatagaccctccggaccccaccaagccagactacgacatccgggccgat
gtgtggagccttggcatctccttggtggagctggcgacgggacagtttccctacaagaac
tgcaagacagactttgaggtcctcaccaaagtcctgcaggaagagcccccgctcttgccc
ggtcacatgggcttctcgggggactttcagtccttcgtcaaagactgccttactaaggat
cacaggaagagaccaaagtataataagctacttgaacacagtttcatcaagcgctacgag
atgctggaggtagacgtggcatcctggttcaaggatgtcatggcgaagaccgagtcaccg
aggactagcggagtcctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system