KEGG   Felis catus (domestic cat): 101086783
Entry
101086783         CDS       T02385                                 
Symbol
RIPK2
Name
(RefSeq) receptor-interacting serine/threonine-protein kinase 2
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca05132  Salmonella infection
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101086783 (RIPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101086783 (RIPK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101086783 (RIPK2)
   05152 Tuberculosis
    101086783 (RIPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086783 (RIPK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101086783 (RIPK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   101086783 (RIPK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase CARD Kdo
Other DBs
NCBI-GeneID: 101086783
NCBI-ProteinID: XP_011289616
Ensembl: ENSFCAG00000018768
UniProt: M3WPQ3
LinkDB
Position
F2:39147944..39177388
AA seq 538 aa
MSREAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPVLDSER
NDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKMEYPVVAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSSPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVITWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPDTNEENLPLDIPHRALMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSTLSTIHLCDKKEMASSLNIPVTHEPQEESCGSSQLHKTSGSTGA
SKSLSASQDSDFLPRKTQDFSTLCHYPVNHSCDSHISVAQKVTCCDHRTAPCSLAVINPL
SAEGNSERLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLIMKEDYELISTKPT
RTSKVRQLLDTTDIQGEEFARVIVQKLKDNKQMGLQPYPEILVVSLSQSLNLCQNKSL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgagccgggaggccatctgcagcgccctgcccaccattccctaccacaagctcgccgac
ctgcgctacctgagccgcggcgcgtcgggcaccgtgtcgtccgcccgccacgcagactgg
cgcgtccaggtggccgtgaagcacctgcacatccacaccccggtgcttgacagcgaaaga
aatgatgttttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttacggaatacatgccaaat
ggatcattaaatgaactcctacataggaaaatggaatatcctgttgttgcttggccactg
agatttcgcattctgcatgaaatcgcactgggtgtaaactacctgcacaatatgaatcct
cctctacttcatcatgacttgaagactcaaaatatcttattggataatgaatttcatgtt
aagattgcagattttggtttatcaaaatggcgtatgatgtccctctcacaatcacgaagt
agtaaatcttcaccagaaggagggacaattatctatatgccacctgagaactatgaacct
ggacaaaaatcaagggccagtgtcaagcatgatatatatagctatgcagttatcacatgg
gaagtcttatccagaaaacagccttttgaagaagtcaccaatcctttgcagatcatgtat
agtgtgtcacaaggacatcgacctgacactaatgaagaaaatttaccattggatatacct
catcgagcactcatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcctaaaatgtttaatagaacttgaaccagttctgaggacatttgaagagata
acttttcttgaagctgttattcaactaaagaaaacaaagttacagagtactttgagcact
attcacttatgcgacaagaaggaaatggcgtcatctctgaacatacctgtaactcatgag
ccacaagaggaatcgtgtggatcctctcagctccataaaactagtggttccactggagcc
tcaaagtccctgtcagcgtctcaagacagtgattttttacctagaaaaactcaagacttc
tctacgctgtgtcactatccagtaaatcacagttgtgacagtcacatttctgtagctcaa
aaggtgacctgttgtgatcacaggaccgccccgtgctctttagcagtgataaatccactc
tcagctgagggaaattcagagcgattacagcctggcatagcccaacagtggatccagagc
aaaagggaagatattgtgagccagatgacagaagcctgccttaaccagtcgctggatgct
cttctgtccagggacttgatcatgaaggaggactatgaactcattagtaccaaacctaca
agaacctcaaaagtcagacagttactggacaccactgacattcaaggagaagaatttgcc
agagttatagtacaaaagttgaaagataacaagcaaatgggtcttcagccttacccggaa
atacttgtggtttctctatcacaatctttaaatttatgtcaaaataaaagcttgtaa

DBGET integrated database retrieval system