KEGG   Felis catus (domestic cat): 101087003
Entry
101087003         CDS       T02385                                 
Symbol
GRIA4
Name
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor 4
  KO
K05200  glutamate receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101087003 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101087003 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101087003 (GRIA4)
   04728 Dopaminergic synapse
    101087003 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    101087003 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101087003 (GRIA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101087003 (GRIA4)
   05022 Pathways of neurodegeneration - multiple diseases
    101087003 (GRIA4)
  09165 Substance dependence
   05031 Amphetamine addiction
    101087003 (GRIA4)
   05033 Nicotine addiction
    101087003 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101087003 (GRIA4)
Ion channels [BR:fca04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101087003 (GRIA4)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061 NAD_binding_1
Other DBs
NCBI-GeneID: 101087003
NCBI-ProteinID: XP_023094824
Ensembl: ENSFCAG00000015605
LinkDB
Position
D1:3729433..4131549
AA seq 902 aa
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRXYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTTIRQSSGLAVIASD
LP
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggtctcttcatccgaaacacagatcaggaa
tacacagcctttcgattagcaatctttcttcacaacactagccccaatgcgtccgaagct
ccttttaatctggtacctcatgtggacaacatcgagacagccaacagttttgccgtgaca
aatgctttctgttcccagtattctagaggagtgttcgccattttcggactctacgataag
aggtcggtacacaccttgacctcgttctgcagcgccttgcacatctccctcatcacaccg
agtttccccacggagggggagagccagtttgtgctgcagctcagaccgtccttgcggggc
gcgctcctgagtctgctggaccactacgaatggaactgtttcgtcttcctgtacgacacg
gacaggtgatactcaatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagacgacaagagaagaaatttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtgagtgttgggaagcatgttaagggttaccactacatcattgca
aacttgggattcaaggatatttctctggagagatttatccatggtggagccaatgttaca
ggattccagctggttgattttaatacacctatggtaaccaaactaatggatcgctggaag
aaactagaccagagagagtatccaggatctgagactcctccaaagtatacgtctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaaatcttaggaggcagaaaatt
gatatttcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaaggactgacaggaaat
gttcagtttgaccactatggacgtagggtcaattacacaatggatgtgtttgagctgaag
agcacagggcctagaaaggttggctactggaatgatatggataaattagtcttgattcag
gacgtgcccactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcgagggacgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctatcgcccct
ctgacaatcactttggtccgagaggaggtcattgacttctctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagcaggttcagtccgtacgagtggcacacagaagagccggaggat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgccttcatgcagcaaggatgtgacatttcacccagatccctctcaggt
cggattgttggaggtgtctggtggttcttcacgctcatcattatatcatcttataccgct
aacctcgctgctttcctgacggtagaacgaatggtctcccccatagaaagtgcggaagac
ctggccaaacaaacagaaattgcctatggaacattggattcagggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtacgaaaagatgtggacctacatgcgatcggcagag
ccgtccgtgttcacgaggactacagctgagggagtggctcgtgtccgcaaatccaagggc
aaatttgcgttcctcctggagtccactatgaacgagtacattgagcagcgaaagccgtgt
gacacgatgaaagtgggaggaaatctggattcgaaaggctatggagtagcaacgcccaag
ggttcctcattaagaaatgctgttaacctggcagttttaaaactgaatgaacaaggcctg
ttggacaaattgaaaaacaaatggtggtacgacaaaggagagtgtggcagcgggggcggt
gactccaaggacaagacgagcgccttgagcctgagcaacgtcgcaggcgttttctacatt
ctggtcggcggcttgggcttggcgatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagcgtgggtgagaacggccgcgttttgacgcccgactgccccaag
gcggtacacacgggaactacgattagacagagttcgggattggctgtcattgcatcggac
ctaccatga

KEGG   Felis catus (domestic cat): 101088234
Entry
101088234         CDS       T02385                                 
Symbol
GRIA2
Name
(RefSeq) glutamate receptor 2 isoform X1
  KO
K05198  glutamate receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101088234 (GRIA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101088234 (GRIA2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101088234 (GRIA2)
   04728 Dopaminergic synapse
    101088234 (GRIA2)
   04720 Long-term potentiation
    101088234 (GRIA2)
   04730 Long-term depression
    101088234 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    101088234 (GRIA2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088234 (GRIA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101088234 (GRIA2)
   05016 Huntington disease
    101088234 (GRIA2)
   05017 Spinocerebellar ataxia
    101088234 (GRIA2)
   05022 Pathways of neurodegeneration - multiple diseases
    101088234 (GRIA2)
  09165 Substance dependence
   05030 Cocaine addiction
    101088234 (GRIA2)
   05031 Amphetamine addiction
    101088234 (GRIA2)
   05033 Nicotine addiction
    101088234 (GRIA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101088234 (GRIA2)
Ion channels [BR:fca04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101088234 (GRIA2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 101088234
NCBI-ProteinID: XP_011279900
Ensembl: ENSFCAG00000024875
UniProt: A0A2I2UTP4
LinkDB
Position
B1:complement(72556633..72716741)
AA seq 883 aa
MQKIMHISALLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgcaaaagattatgcatatatctgccctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttcccaggggcgccgatcaggaa
tacagtgcatttcgggtagggatggttcagttttccacttcggagttcagactgactccc
cacatcgacaatttggaggtagcaaacagcttcgcagtcaccaatgctttctgctcccag
ttttcaagaggagtctatgctattttcggattttatgataagaagtctgtaaataccatc
acatcattttgtggaacgctccatgtctccttcatcactcccagcttcccaacagatggt
acacatccatttgtcatccagatgagacctgacctcaaaggagcgcttcttagcttgatt
gaatactatcagtgggacaagtttgcatatctctatgacagtgacagaggcttatcaacg
ctgcaggcagtgctggactccgctgctgagaagaaatggcaggtgaccgctatcaatgtg
ggaaatattaacaatgacaagaaagatgagacgtaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtcatcctggactgtgaacgggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaaggttaccattatatcattgcaaatctg
ggctttactgatggagacctattaaaaattcagtttggaggtgcaaacgtctctggattt
cagatagtggactatgatgattccctggtatctaaatttatagaaagatggtcaacgctg
gaagaaaaagaataccctggagcacacacgactacaattaagtatacttctgctctgacc
tacgacgctgttcaagtgatgactgaagctttccgcaacctacggaagcagagaattgaa
atctcccgcaggggaaacgcgggagactgtctggcaaacccagcagtcccctggggacaa
ggcgtagaaatagaaagggccctcaaacaggttcaggttgaaggtctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacaattaacatcatggaactcaaaact
aatgggccccggaagattggatactggagtgaagtagacaaaatggttgttaccctcact
gagctcccctctggaaacgatacctctgggctcgagaataagactgttgttgtcactaca
attttggaatctccatatgttatgatgaagaaaaatcatgaaatgcttgaaggcaatgag
cgttatgagggctactgtgttgacttggctgcagaaatcgccaaacattgtgggttcaag
tacaagttgacaattgttggggatggcaagtatggggccagggatgctgacacgaaaatt
tggaatgggatggttggagaacttgtatatgggaaagctgacattgcaattgctccatta
actattacccttgtgagagaagaggtgattgacttctcaaagccctttatgagcctcggg
atatctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcatttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcagcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggatccaccaaagagtttttc
aggagatctaaaattgcagtgtttgataaaatgtggacctacatgagaagtgcagagccc
tctgtgtttgtgaggactacggctgaaggggtagccagagtgcggaagtccaaaggaaaa
tacgcctacttgctggagtccacgatgaatgagtacattgagcaaaggaagccctgtgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcttcattaagaaatgcggttaacctcgcagtactaaaactgaatgaacaaggcctgttg
gacaaattgaaaaacaaatggtggtacgacaaaggagagtgcggcagcgggggaggtgat
tccaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcg
cagaattcacagaattttgcaacttataaggaaggttacaacgtatatggcatcgaaagt
gttaaaatttag

KEGG   Felis catus (domestic cat): 101089925
Entry
101089925         CDS       T02385                                 
Symbol
GRIA3
Name
(RefSeq) glutamate receptor 3 isoform X1
  KO
K05199  glutamate receptor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05033  Nicotine addiction
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101089925 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101089925 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101089925 (GRIA3)
   04728 Dopaminergic synapse
    101089925 (GRIA3)
   04730 Long-term depression
    101089925 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    101089925 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101089925 (GRIA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101089925 (GRIA3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101089925 (GRIA3)
   05017 Spinocerebellar ataxia
    101089925 (GRIA3)
   05022 Pathways of neurodegeneration - multiple diseases
    101089925 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    101089925 (GRIA3)
   05033 Nicotine addiction
    101089925 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101089925 (GRIA3)
Ion channels [BR:fca04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101089925 (GRIA3)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 NusG_add DUF2061
Other DBs
NCBI-GeneID: 101089925
NCBI-ProteinID: XP_004000902
Ensembl: ENSFCAG00000008299
UniProt: A0A2I2UBD3
LinkDB
Position
X:103173624..103439996
AA seq 894 aa
MARQKKMGQNVLRAVFLLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNL
AVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaaacgtgctccgggcggtcttccttttagtcctg
gggcttttgggtcattctcacggaggattccccaacaccatcagcatcggtggacttttc
atgagaaacacggtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccacggagaagcccttccatttgaattaccacgtagatcacttggattct
tccaatagtttttctgtgactaatgctttctgctcccagttctcaagaggggtgtacgcc
atctttggattctatgaccagatgtcaatgaacactctgacctccttctgtggggccctg
cacacatcctttgtgacgcccagcttccccactgacgcagacgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtctgctgggtcactacaagtgggagaag
tttgtgtacctctacgacacagaaagaggattttccattctccaagcgatcatggaagca
gccgtgcaaaacaactggcaagtgacagcaaggtctgtgggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgtgaagtcgaaaggattaacacaattttggaacaggttgtgatcctgggaaaacattca
agaggttatcactacatgcttgctaacctgggttttaccgatattttgctagaaagagtc
atgcatgggggagccaacattacaggattccagattgtcaacaatgaaaaccctatggtt
cagcagtttattcagcgctgggtgaggctagatgaaagggaattccctgaagccaagaat
gcaccactaaagtatacatctgcgctgacgcacgatgcaatactggtcatcgcagaagct
ttccgctacctgaggaggcagcgagtggatgtatcccgaagaggcagtgctggagactgc
ttggcaaatcccgctgtgccctggagtcaaggaattgatatcgagagagctctaaaaatg
gtacaagtacaaggaatgaccggaaacatccaatttgacacttacggacgtaggacaaat
tataccatcgatgtgtacgagatgaaagtcactggctctcgaaaagctggctactggaat
gagtacgaaagatttgtgcctttctcagatcagcaaatcagcaatgacagcgcatcctca
gagaaccggaccattgtagtgactaccattctggaatcaccatatgtaatgtataagaag
aaccatgagcaactggaaggaaatgagagatatgaaggctattgtgtcgacttagcctat
gaaatagccaaacacgtgaggatcaaatacaaattgtccattgtcggcgacgggaaatat
ggcgcaagggatccagagacaaaaatatggaatggcatggttggggaacttgtctatggg
agggctgatatagctgtcgctccactcaccataaccctggtccgtgaagaagtcatagat
ttctcaaagccgtttatgagcctgggcatctccatcatgataaagaagcctcagaaatca
aaaccaggcgtattctcatttctggatcccttggcttatgaaatctggatgtgcatcgtc
ttcgcctacattggagtcagtgtagttcttttcctggtcagcagattcagcccctatgaa
tggcacttggaagacaacaatgaagaacctcgtgatccgcaaagccctcctgaccctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaaggc
tgtgatatttctccaaggtcgctgtccgggcggattgtcggaggggtttggtggttcttc
accctgatcataatttcttcctacactgccaatcttgctgctttcctgactgtggagagg
atggtctctcccatagagagtgctgaagacttagctaagcagactgaaattgcatatggg
accctggactccggttcaacgaaagaatttttcagaaggtccaaaattgctgtctatgag
aaaatgtggtcttacatgaaatcagcagagccatctgtgtttaccaaaacaacagcagac
ggagtggcccgggtgcggaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccgtgtgataccatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaagaacgcctgtaaacctt
gcagtattgaaactcagtgaacaaggcatcttagacaagctgaaaaacaaatggtggtac
gataagggggagtgtggagccaaggactccgggagtaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggcgttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaagcctgctcctgccaccaacactcaaaattacgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaagatctag

KEGG   Felis catus (domestic cat): 101097621
Entry
101097621         CDS       T02385                                 
Symbol
GRIA1
Name
(RefSeq) glutamate receptor 1 isoform X2
  KO
K05197  glutamate receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101097621 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101097621 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101097621 (GRIA1)
   04728 Dopaminergic synapse
    101097621 (GRIA1)
   04720 Long-term potentiation
    101097621 (GRIA1)
   04730 Long-term depression
    101097621 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    101097621 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101097621 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101097621 (GRIA1)
   05016 Huntington disease
    101097621 (GRIA1)
   05017 Spinocerebellar ataxia
    101097621 (GRIA1)
   05022 Pathways of neurodegeneration - multiple diseases
    101097621 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101097621 (GRIA1)
   05033 Nicotine addiction
    101097621 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101097621 (GRIA1)
Ion channels [BR:fca04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101097621 (GRIA1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 101097621
NCBI-ProteinID: XP_003981414
Ensembl: ENSFCAG00000005223
UniProt: M3W3P3
LinkDB
Position
A1:complement(195860037..196167683)
AA seq 906 aa
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGTSGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaacatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcacaactcacagagcccccaaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctctaaa
ggagtctacgccatctttgggttttatgaacggagaactgtcaacatgctgacctccttc
tgtggggccctccacgtctgcttcatcacaccgagcttccccgttgacacctccaatcag
tttgtccttcagctacgccctgagctgcaggatgctcttatcagcatcatcgaccattac
aagtggcagaaattcgtctacatttatgatgccgaccggggtttgtccgtcctgcagaaa
gtactggacacagctgctgagaagaactggcaggtgacagcggtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggaaaagaaaaaggagcggctagtg
gtggtggactgtgaatcagaacgtctcaacgctatcttgggccagattatcaagctggag
aagaatggcatcggctaccactacatccttgcaaatctgggtttcatggacattgactta
aacaaattcaaagagagtggagcaaatgtaacaggtttccagttggttaactacacagac
accatcccagccaaaatcatgcagcagtggaagaacagcgatgctcgcgaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgacggggtgaaggtgatg
gctgaggcttttcagagcctgcggaggcagagaatcgatatatcccgccgggggaatgct
ggggactgcctggctaacccagctgtgccctggggccaggggatcgacatccaaagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaatgttcaatttaatgagaagggacgc
cggaccaactacaccctccatgtgattgaaatgaagcatgatggcatccgaaagatcggt
tactggaatgaagatgataagtttgtccctgcagccactgatgctcaagctgggggggac
aattcaagtgtccagaacagaacatacatcgttactacaatcctagaagatccgtatgtg
atgctcaagaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgta
gagctggcagcagagattgccaaacatgtgggctactcctaccgtcttgagattgtcagc
gatggaaaatatggagcccgtgaccctgacaccaaggcttggaatggcatggtgggagag
ctggtctatggaagagccgatgtggccgtggctcctttaactatcaccttggtccgggaa
gaggtgatagatttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccgcagaagtccaagccgggggtcttctccttcctcgatcctttggcttatgaaatttgg
atgtgcattgtctttgcctacattggagtgagtgtcgtccttttcctggtcagccgcttc
agcccctatgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagtgac
caatccaatgagtttgggatattcaacagtttgtggttctccctgggagcattcatgcaa
caaggatgtgacatttctcccaggtccctgtctggccgcatcgttggtggtgtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggctgccttcttgaccgtg
gagaggatggtgtctcccatcgagagtgctgaggacctagcgaaacagacggaaatcgct
tacggcacactggaagcagggtccactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaaaatgtggacatacatgaagtcagcagaaccatcagtttttgtgcgaaccacg
gaggaaggaatgatccgagtgagaaaatccaaaggcaaatacgcctaccttctggagtct
accatgaatgaatacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagtgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgattggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatctatcaatgaagccatacggacatcgacactcccg
cgaaacagtggggcaggaaccagcggtggcggcagtggagaaaacggccgggtggtcagc
catgacttccccaagtccatgcagtcgattccctgcatgagccacagttcagggatgccc
ttgggagccacaggattgtaa

DBGET integrated database retrieval system