KEGG   Felis catus (domestic cat): 101087013
Entry
101087013         CDS       T02385                                 
Symbol
SYK
Name
(RefSeq) tyrosine-protein kinase SYK isoform X3
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05152  Tuberculosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101087013 (SYK)
   04072 Phospholipase D signaling pathway
    101087013 (SYK)
   04151 PI3K-Akt signaling pathway
    101087013 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101087013 (SYK)
   04613 Neutrophil extracellular trap formation
    101087013 (SYK)
   04625 C-type lectin receptor signaling pathway
    101087013 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    101087013 (SYK)
   04662 B cell receptor signaling pathway
    101087013 (SYK)
   04664 Fc epsilon RI signaling pathway
    101087013 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    101087013 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101087013 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101087013 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101087013 (SYK)
   05168 Herpes simplex virus 1 infection
    101087013 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101087013 (SYK)
   05169 Epstein-Barr virus infection
    101087013 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087013 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101087013 (SYK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101087013 (SYK)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  SYK family
   101087013 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kdo ABC1
Other DBs
NCBI-GeneID: 101087013
NCBI-ProteinID: XP_019671258
Ensembl: ENSFCAG00000014214
LinkDB
Position
D4:3833594..3916666
AA seq 361 aa
MVSGWNYLKNQIILLPKAWPQKGLHIPREPARERRDLQSVRAGPRALAHGQSLCLPDHPA
DAQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDNELGSGNFGTVKKGYYQMKK
VVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELG
PLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFG
LSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYR
GMKGSEVSAMLEKGERMGCPTGCPREMYELMKLCWTYEVESRPGFAAVELRLRNYYYDVV
N
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggtcagcgggtggaattatctcaagaatcaaatcatactccttcccaaagcctggcca
cagaaaggcctccacatcccaagggagccggccagagagcgccgtgaccttcaatccgta
cgagccggaccgcgggccctggcccacggacagagcttgtgtcttccggaccaccctgca
gacgcccagagagaggccttgcccatggacaccgaggtgtatgaaagcccgtatgcggac
cctgaggagatcaggcccaaggaagtctacctggaccgcaagctgctgaccctggaggac
aacgaactgggctctggtaacttcgggaccgtgaagaagggctactaccagatgaaaaaa
gtcgtgaaaacggtggctgtgaagattctgaagaacgaggctaacgaccccgctcttaaa
gatgagttattagcggaagccaatgtcatgcagcagctcgataacccttacatcgtgcgc
atgatcggcatctgtgaagccgagtcctggatgctggtgatggagatggcggaactgggt
ccgctcaacaagtatttacagcagaacaggcacgtcaaggataagaacatcatagagctg
gttcatcaggtttctatgggaatgaagtatctggaggagagcaattttgtgcacagggat
ctggcggcaagaaacgtcttgctggttactcaacactatgccaagatcagtgattttgga
ctttccaaagcgctccgtgctgatgaaaactactacaaggcccagacccacgggaagtgg
ccggtcaagtggtacgcccccgagtgcatcaactactacaagttctccagcaagagtgac
gtctggagcttcggcgtgttgatgtgggaggcgttctcctacgggcagaagccgtaccgg
ggcatgaagggaagcgaggtttcggccatgctggagaaaggagagagaatggggtgcccc
acggggtgtccgagggagatgtacgagctgatgaagctgtgctggacgtatgaggtggag
agcaggcccggattcgcagccgtggaactgcgtctacgcaattattactacgacgtggtc
aattaa

DBGET integrated database retrieval system