KEGG   Felis catus (domestic cat): 101087171
Entry
101087171         CDS       T02385                                 
Symbol
PAK1
Name
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04360  Axon guidance
fca04392  Hippo signaling pathway - multiple species
fca04510  Focal adhesion
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101087171 (PAK1)
   04012 ErbB signaling pathway
    101087171 (PAK1)
   04014 Ras signaling pathway
    101087171 (PAK1)
   04392 Hippo signaling pathway - multiple species
    101087171 (PAK1)
   04024 cAMP signaling pathway
    101087171 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101087171 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087171 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101087171 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    101087171 (PAK1)
   04660 T cell receptor signaling pathway
    101087171 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    101087171 (PAK1)
   04062 Chemokine signaling pathway
    101087171 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    101087171 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101087171 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101087171 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101087171 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101087171 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101087171 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087171 (PAK1)
   03036 Chromosome and associated proteins [BR:fca03036]
    101087171 (PAK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101087171 (PAK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE20 family
   101087171 (PAK1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101087171 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    101087171 (PAK1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101087171 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal DSHCT APH Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 101087171
NCBI-ProteinID: XP_003992751
Ensembl: ENSFCAG00000004158
UniProt: M3W1P1
LinkDB
Position
D1:56771849..56928232
AA seq 544 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTIPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAFFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacctccagcccctccgatgagaaacacc
agcactatgattggagctggcagcaaagatgctggaaccctaaaccacggttccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttcagat
tttgagcacacaattcacgttggttttgatgctgtcacaggggagtttacaggaatgcca
gagcagtgggctcgcttgcttcaaacatcaaatatcactaagtcagagcagaagaaaaac
ccacaagctgttctggatgtattggaattttataactcaaagaagacctccaacagccag
aagtacatgagctttacagataaatcagctgaagattataattcttctaacactttgaat
gtgaagacggtgtctgagactcctgcagtgccaccagtttccgaagatgaagatgatgat
gatgatgctacccctcctccagtgattgctccacgcccagagcacacaaaatctgtatac
acacggtctgtgattgaaccgcttcctgttactccaactcgggatgtggctacatctccc
atttcacctactgagaataataccattccaccagatgctctgacccggaatactgagaag
cagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacggagcatagtg
agtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgcttca
ggcactgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcagatg
aaccttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaagaacccaaatattgtcaactacttggacagttacctcgtgggagatgagctgtgg
gttgtcatggaatacttggctggaggctctttgacagatgtggtaacagaaacttgcatg
gatgaaggccagatcgcagctgtctgccgtgagtgcctgcaggctttggagtttctgcat
tcgaaccaggtcattcacagagacatcaagagtgacaatatcctgttgggaatggatggt
tctgtcaagctaactgactttggattctgtgcccagatcaccccagagcagagcaaacgg
agcaccatggtgggaaccccatactggatggcaccagaggttgtgacacggaaagcctat
gggcccaaggttgacatctggtccctgggcatcatggccattgaaatgattgaaggggag
cccccatacctcaatgaaaatcctctcagagccttgtacctcattgccaccaatgggacc
ccggagcttcagaacccagagaagctatcagcttttttccgggactttctgaaccgctgt
cttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcagttcctg
aagattgccaagcccctttccagcctcactccactgattgctgcagcaaaggaggcaacc
aagaacaatcactaa

DBGET integrated database retrieval system