KEGG   Felis catus (domestic cat): 101087199
Entry
101087199         CDS       T02385                                 
Symbol
THBS4
Name
(RefSeq) thrombospondin-4
  KO
K04659  thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101087199 (THBS4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101087199 (THBS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087199 (THBS4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101087199 (THBS4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101087199 (THBS4)
  09174 Infectious disease: parasitic
   05144 Malaria
    101087199 (THBS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087199 (THBS4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087199 (THBS4)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101087199 (THBS4)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101087199 (THBS4)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101087199 (THBS4)
  Exosomal proteins of colorectal cancer cells
   101087199 (THBS4)
  Exosomal proteins of bladder cancer cells
   101087199 (THBS4)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101087199 (THBS4)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 cEGF EGF
Other DBs
NCBI-GeneID: 101087199
NCBI-ProteinID: XP_003981157
Ensembl: ENSFCAG00000003879
UniProt: M3W148
LinkDB
Position
A1:146252507..146296122
AA seq 964 aa
MLAPRGAAFLLLHLALQPWLGAGAQATPQVFDLLPSSSQRLNPAVLQPILTDPTLNEVYV
ISTFKLHSKSSSTILGLYSSVDGSKYFEFTVMGRLNKAVLRYLKNDGRIHLVVFNNLHLA
DGRRHRVLLRLTNLRRGTGSVELYMDCTQVDSVHNLPRAFSGSSQSPESIELRTFQRKAQ
DSLEELKLVVRGSLFQVASLQDCFLQQSEPLATTSTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPPASPAPTTSSTPPVRRCDSNSCFR
GVRCTDTRDGFQCGPCPEGYTGNGITCSDIDECKYHPCYPGVRCVNLAPGFRCDACPMGF
TGPMVQGVGISFAKSNKQVCTDIDECQNGACVLNSICINTLGSYRCGPCKPGYTGDQTTG
CKTERSCRNPELNPCSVNAQCIEERQGDVTCVCGIGWAGDGYICGKDVDIDSYPDEELPC
SARNCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKD
IFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKVPNRDQRDRDGDG
VGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKD
GIGDECDDDDDNDGIPDVVPPGPDNCRLVPNPAQEDSNSDGVGDICETDFDQDQVIDRID
VCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
GVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLK
AVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVR
FYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFD
RLDN
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccttcctcctgctgcacctggccctgcagccgtggcta
ggggccggcgcccaggccaccccccaggtctttgaccttctcccatcttccagccagagg
ctgaacccagctgttctgcagccaatcctgacagatcccaccttgaatgaggtctatgtg
atctccaccttcaagctgcattctaaaagttcatccaccatcttgggcctttactcttca
gttgatggcagcaaatattttgaattcactgtgatgggacgcttaaacaaagctgtactc
cgttacctgaagaacgatgggaggattcatttggtggttttcaacaacctgcatctggct
gatggcaggcggcacagggtcctcctgagactcaccaacttgcggcgagggactggctct
gtagagctctacatggactgcacccaagtggattctgttcacaatctccccagagccttt
tccggctcttcccagagtcctgagtccattgaattaaggaccttccagaggaaggcacag
gattccttggaagagctgaagctggtggtgaggggctcactgttccaggtggccagcctg
caagactgcttcctacagcagagcgagccactggccaccacaagcacaggagactttaat
cggcagttcttggggcaaatgacccaactcaaccagctcctgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacatcatttttgcgaaataccatagctgagtgccaggct
tgcggtccactgagctttcagtctccaaccccaaacacgctggtgccccctgcatcccca
gcgcccacgacatcctcgacacccccagtgcgccgctgtgattctaactcctgtttccgc
ggcgtccgatgtactgacaccagagatggctttcaatgtgggccctgccctgagggctac
acaggaaatgggatcacctgttctgatattgatgagtgcaaataccatccctgctaccca
ggtgtgcgctgtgtgaacttggctcccggcttcagatgtgatgcgtgccccatgggcttc
acagggcccatggtacagggtgttgggatcagttttgccaagtcaaacaagcaggtctgc
actgacattgatgagtgtcaaaacggagcgtgtgttctcaactctatctgtattaacact
ctgggatcttaccgctgcgggccttgcaaaccggggtacactggtgatcagacaacggga
tgcaaaaccgaaaggagctgcagaaatcctgagctgaatccttgcagtgtgaatgcacag
tgcattgaagagaggcaaggggatgtgacatgtgtgtgtggcattggttgggctggcgat
ggctatatctgcggaaaggatgtggacattgacagttaccccgacgaagaactgccgtgc
tctgccaggaactgcaagaaggataattgcaagtatgtgccaaattctggccaagaagat
gcagacagagatggcataggagatgcttgtgacgacgacgctgacggagacgggatcttg
aatgagcaggataactgtgtcctgactcacaatgtggaccaaaggaacagtgacaaagat
atctttggggacgcctgtgacaactgccggaatgtcctgaataatgaccagaaagacact
gatggagatggaaaaggagacgcctgtgatgatgacatggatggagatggaataaaaaac
attctggacaactgcccaaaagttcccaatcgtgaccaacgggacagggatggtgatggc
gtgggggatgcctgtgacagttgtcctgatgtcagtaaccctaaccagtctgatgtggat
aacgacctggttggggactcctgtgacaccaatcaggacagtgatggagatggacaccag
gacagcacagacaactgccccaccgtcattaacagcgcccagctggacactgataaggat
ggcatcggtgacgagtgtgatgacgatgatgacaacgatggcatcccagacgtggtgccc
ccgggaccagacaactgcaggctggtccccaacccagcccaggaggatagcaacagcgat
ggcgtgggagacatctgtgagactgactttgaccaggaccaggtcatcgatcggatcgat
gtctgcccagagaatgcggaggtcacactgactgacttcagggcctaccagacagtagtc
ctggaccctgaaggggatgcccagatcgatcccaattgggtggtcctgaaccagggcatg
gagattgtgcagactatgaacagcgatcctggcctggcagtggggtacacggcatttaac
ggagttgactttgaagggaccttccacgtaaacacccagacagatgacgactacgctggc
ttcatctttggttaccaagacagctccagcttctacgtagtcatgtggaagcagacagag
cagacatattggcaagccacgccattccgcgctgtggcggaacctggcatccagcttaag
gctgttaagtctaagacaggcccgggggagcatctccgcaactccctgtggcacaccggg
gacacgagtgaccaggtccggctgctgtggaaggactcgaggaacgttggctggaaggac
aaggtgtcctaccgctggttcctgcagcacaggccccaggtgggctacataagagtgcgc
ttttatgaaggctctgagttggtagctgactccggggtcaccatagacaccaccatgcgt
ggaggccggctcggcgtgttctgcttctcccaagaaaacatcatttggtccaacctcaaa
tatcgctgcaatgacaccatcccagaggacttccaagagtttcaaacccagaatttcgat
cgcctggataattaa

KEGG   Felis catus (domestic cat): 101088820
Entry
101088820         CDS       T02385                                 
Symbol
COMP
Name
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101088820 (COMP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101088820 (COMP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088820 (COMP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101088820 (COMP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101088820 (COMP)
  09174 Infectious disease: parasitic
   05144 Malaria
    101088820 (COMP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088820 (COMP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088820 (COMP)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101088820 (COMP)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101088820 (COMP)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101088820 (COMP)
  Exosomal proteins of colorectal cancer cells
   101088820 (COMP)
  Exosomal proteins of bladder cancer cells
   101088820 (COMP)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101088820 (COMP)
SSDB
Motif
Pfam: TSP_C TSP_3 EGF_CA EGF_3 COMP cEGF EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 101088820
NCBI-ProteinID: XP_003982134
Ensembl: ENSFCAG00000009754
LinkDB
Position
A2:complement(13900923..13909129)
AA seq 756 aa
MVPAAACVLLLTLAALGASGQGQIQIGADLGPQMLRELQETNAALQDVRELLRQQVKEIT
FLKNTVMECDACGMQPARTPGLSVRPLSQCAPGFCYPGVVCTQTASGARCGPCPAGFTGN
GSHCVDVNECNAHPCFPRVRCINTSPGFRCEACPPGFSGPAHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQASGCRRRSQRFCPDGTPSPCHEKA
DCILERDGSRSCVCAVGWAGNGLVCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQE
DVDRDGIGDACDPDADGDGVLNEQDNCKLVRNPDQRNADGDKWGDACDNCRSQKNDDQKD
TDQDGKGDACDDDIDGDRIRNTVDNCPRVPNSDQKDSDGDGVGDACDNCPQKSNADQSDV
DHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDEDDDNDGVPDSR
DNCRLVPNPNQEDVDRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIF
GYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTA
SQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGR
LGVFCFSQENIIWANLRYRCNDTIPEDYETQRLLQA
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggttcctgccgccgcctgcgttctcctgctcaccctggcagccctcggtgcgtcgggc
cagggccagatacagataggtgcagatctgggcccgcagatgcttcgggaacttcaggaa
accaacgcggctctgcaggatgtgcgggagctgttgcggcagcaggtcaaggagatcacg
tttctgaaaaacacagtgatggagtgtgacgcgtgcgggatgcagccggcgcgcacccca
ggtctgagcgtgcggcccctctcccagtgcgcgcccggcttctgctacccaggcgtggtt
tgcactcagacggcaagcggcgcgcgctgtggaccttgccccgcgggcttcactggcaat
ggctcgcactgtgtcgacgtcaacgagtgcaacgcccatccctgcttcccgcgcgtccgc
tgcatcaacactagccccggcttccgctgcgaggcttgccctcccgggttcagcggcccc
gcccacgagggcgtggggctggccttcgccaaagccaacaagcaggtttgcacggacatt
aacgagtgtgagaccggacagcacaactgcgtccccaactccgtgtgcgtcaatacccgg
ggctccttccagtgcggcccttgccagcccggcttcgtgggcgaccaggcatctggctgc
cgtcggcgctcacagcgcttctgccccgacggcacgcccagcccgtgccacgagaaggcc
gactgcatcctggaacgcgatggctcgaggtcgtgcgtgtgcgccgttggctgggccggc
aacggcctcgtctgcggccgagacacggatttggacggcttccccgacgagaagctgcgc
tgcccggaacgccagtgccgcaaggacaactgcgtgacggtgcccaactcagggcaagag
gacgtggatcgcgacggcatcggagacgcctgcgacccggatgccgacggggacggggtc
ctcaacgagcaggacaactgtaaactggtgcgcaacccagaccagcgcaatgcggacggc
gataagtggggtgatgcgtgcgacaactgccggtcccagaagaacgatgaccaaaaggac
acagatcaggacggcaaaggcgacgcctgcgacgacgacatcgacggcgaccggatccga
aatacggtggacaactgcccaagggtgccgaactcagaccagaaggacagcgatggtgat
ggtgtaggggatgcctgtgacaactgcccccagaagagcaacgcagaccagagtgatgtg
gaccacgactttgtgggagacgcttgcgacagcgaccaagaccaggatggggatgggcac
caggactcacgggacaactgccctacagtaccaaatagtgcccagcaggattcagatcac
gatggccagggtgacgcctgcgacgaggatgatgacaacgacggggtccctgacagtcgg
gacaactgccgcctggtgcccaacccaaatcaggaagatgtagaccgggacggagtgggc
gacgtgtgccagggcgacttcgacgcggacaaagtggtggacaagatcgatgtgtgtccg
gagaacgccgaggtcaccctcactgacttccgggccttccagacggtcgtgctggacccc
gaaggcgacgctcagatagatcccaactgggtggtgctcaaccagggtatggagatcgtg
cagacgatgaacagcgaccctggcctggctgtgggttacacggccttcaatggcgtggac
tttgaaggcacgttccacgtgaacacggtcacggatgacgactacgcaggcttcatcttt
ggctaccaggacagctccagcttttatgtggttatgtggaagcagatggaacagacgtac
tggcaggcgaatcctttccgtgcagtggctgaacccggcattcagctcaaggctgtgaag
tcctccacaggccccggggagcagctgcggaatgcactctggcacacgggggacacagcg
tcgcaggtgcggctgctgtggaaggacccccgcaacgtgggttggaaggacaagacgtcc
taccgctggttcctgcagcaccggcctcaagtgggctacatcagagtgcggttctacgag
ggccccgagctggtggctgacagcaacgtggtcctggacacgaccatgaggggtggccgc
ctgggggtcttttgcttctcccaagagaacatcatctgggccaatctgcgttaccgctgc
aatgacaccatccctgaggactacgagactcagaggctgctgcaggcctag

KEGG   Felis catus (domestic cat): 101092689
Entry
101092689         CDS       T02385                                 
Symbol
THBS1
Name
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04115  p53 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04350  TGF-beta signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092689 (THBS1)
   04350 TGF-beta signaling pathway
    101092689 (THBS1)
   04151 PI3K-Akt signaling pathway
    101092689 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092689 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101092689 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101092689 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092689 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101092689 (THBS1)
   05205 Proteoglycans in cancer
    101092689 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101092689 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101092689 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    101092689 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092689 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101092689 (THBS1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101092689 (THBS1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101092689 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA TSP1_CCN Laminin_G_3 Laminin_G_2 EGF
Other DBs
NCBI-GeneID: 101092689
NCBI-ProteinID: XP_011281379
Ensembl: ENSFCAG00000011449
UniProt: M3WF45
LinkDB
Position
B3:complement(65612772..65628495)
AA seq 1170 aa
MGLAWGLSVLFLLHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDSSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGKAGTLDLSLTVQGMQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLANVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACRRDACPINGGWGPWSLWDICSVTCGGGVQTRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCKDIDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctcttcctgttgcatgtatgtggctccaaccgt
attccagaatccgggggagacaacagcgtgttcgacatctttgaactcacgggcgctgcc
cggaagggctctgggcgccggctggtgaaggggcctgactcttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gccgtgcgggcagagaaaggcttccttctcttggcctccctgaggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactcgggccaggttttcagtgtggtc
tccaatggcaaggcgggcaccctggacctgagcctaaccgtgcaggggatgcagcatgtg
gtgtcggtggaagaagcgctcctggcgaccggccaatggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaacgccgagctggat
gtccccatccaaagcatcttcaccagggacctggccaacgttgccagactccgcatcgca
aaaggaggtgtcaatgacaatttccagggggtgctgcagaatgtgaggttcgtcttcgga
accacaccagaagccatcctcaggaacaaaggctgttcgagctctaccaatgttcttctc
acccttgacaacaacgtggtaaacggctccagccctgccatccggactaactacattggc
cacaagacaaaggatctgcaagccatctgtggcatttcgtgcgatgagctgtccagcatg
gtcctggagttgaggggcctgcgcaccatcgtgaccaccctccaggacagcatccgcaaa
gtgactgaagagaacaaggagttggccaatgagctaaggaggcctcccctctgctaccac
aacggagttcagtacaggaataacgaggaatggactgttgatagctgcacggagtgtcgc
tgtcagaactctgttaccatctgcaaaaaagtgtcctgccccatcatgccctgctccaat
gccacagttcccgatggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccgtggtctgagtggacctcctgctctgtgacctgtggcaacggaatccag
cagcgcggtcgctcctgtgacagcctcaacaaccgctgcgagggctcctccgtccagact
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttctgtgacatgcggtgacggtgtgatcacaaggatccga
ctctgcaattcccctagcccccagatgaacgggaagccgtgtgaaggcgaagctcgagag
accaaggcctgcaggagagacgcgtgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttctgtcacctgcggaggaggggtgcagacacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgcgacagaaaaccagatc
tgcaacaagcaggactgtccaattgacggatgcctgtccaatccctgctttgctggggtc
aagtgtaccagttaccctgacggcagctggaaatgtggtgcttgtccccccggctacagt
ggaaatggcatccaatgcaaagacatcgatgagtgcaaagaagtacctgacgcctgcttc
aaccacaacggggagcacaggtgtgagaacacggacccgggctacaactgtctgccctgc
cccccacgcttcactggcccgcagcccttcggccggggtgtggaatatgccaccgccaac
aaacaggtatgcaagccccgcaacccctgcacagatgggacacacgactgcaacaagaac
gccaagtgcagctacctgggccattacagtgaccccatgtaccgctgtgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggtgaggacacggacctggacggctggcccaac
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataattgccccaac
cttcccaactccgggcaggaagactatgacaaggatggaattggcgacgcctgtgatgac
gacgacgacaatgataaaatcccagatgacagggacaactgtccattccactataaccca
gcccagtatgactatgaccgggatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacagacaacaacggggaaggagatgcctgcgccgctgac
atcgacggggatggtatcctcaatgaacgagacaactgccagtacgtctacaacgtggac
cagagggacacggatatggatggggtcggcgatcagtgtgacaactgccccctggaacac
aatccagatcagctcgactctgactcagaccgcatcggagacacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaacctggacaattgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaggacggcaagggagacgcctgcgaccatgatgatgacaac
gatggcattcctgatgatagggacaactgcagactcgtgcccaatcctgaccagaaggat
tctgacggtgacggtcgaggtgatgcttgcaaagatgattttgaccatgacaatgtgcca
gacattgatgacatctgtcccgaaaacattgatatcagtgagaccgatttccgccgattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtgcgc
catcagggtaaagaactcgtccagactgtcaactgcgatccaggacttgctgtaggttac
gatgagtttaatgcagtggacttcagtggcaccttcttcatcaacactgagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttttatgtggtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccactagggctcagggatactcaggc
ctttctgtgaaagtggtgaactccacaacagggccaggcgagcacctacggaacgccctg
tggcacacgggaaacacccccggccaggtgcgcactctgtggcatgaccctcgtcacata
ggctggaaagatttcactgcctacaggtggcgtctcagccaccgaccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgattcaggacccatctacgac
aaaacctatgctggaggtagactggggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgcagagattcctaa

KEGG   Felis catus (domestic cat): 101093580
Entry
101093580         CDS       T02385                                 
Symbol
THBS3
Name
(RefSeq) LOW QUALITY PROTEIN: thrombospondin-3
  KO
K04659  thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101093580 (THBS3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101093580 (THBS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101093580 (THBS3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101093580 (THBS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101093580 (THBS3)
  09174 Infectious disease: parasitic
   05144 Malaria
    101093580 (THBS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093580 (THBS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093580 (THBS3)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101093580 (THBS3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101093580 (THBS3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101093580 (THBS3)
  Exosomal proteins of colorectal cancer cells
   101093580 (THBS3)
  Exosomal proteins of bladder cancer cells
   101093580 (THBS3)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101093580 (THBS3)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1
Other DBs
NCBI-GeneID: 101093580
NCBI-ProteinID: XP_023103149
Ensembl: ENSFCAG00000006584
LinkDB
Position
F1:70369527..70379493
AA seq 956 aa
METQELRGALALLLLCTLACASQDLQVIDLLTVGESRQMTAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSLALQLYVDCKLGDQHAGLPGLAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHRAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGVSCINTMPGFRCEACPQGYKGTRVSGVGIDY
ARASKQVCQDIDECSDGNNGGCDPNSICTNTVGSFKCGPCRLGFVGNQSQGCVPARTCHS
PAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQAXPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRA
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctctgcactctcgcatgt
gccagtcaggacctgcaggtgattgacctgctgactgtgggcgagtctcggcagatgacc
gctgtggcagagaagatccggaccgccctgctcactgctggggacatctacctcttgtcc
accttccgcctgccccccaaacagggtggtgtcctctttggcctctactctcggcaggac
aacacacgatggctggaggcctctgttgtgggcaaaatcaacaaagtgctggtgcggtac
cagcgggaggacggcaaggtccacgcggtgaacctgcagcaggcgggcctggccgacggg
cgcacgcacacggctctcctgcgactccgaggtccctcccgacccagcctcgccctgcag
ctctacgtggactgcaaactgggtgaccagcacgccgggctcccagggctggcccccatt
cctccagcggaggtggacgggctggagattaggaccggacagaaggcttatttgaggatg
cagggctttgtggagtctatgaaaatgattctgggcgggtccatggcccgggtgggagcc
ctgagtgagtgtccgttccagggggacgagtccatccacagagcagtgaccaacgcgctc
cattccatcctgggggagcagaccaaggcgctggtcacccagctcaccctcttcaaccag
atcctggtggagctgcgggatgacatccgagaccaggtgaaggaaatgtccctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccacgagcagcgttcacactgcagcccc
aacccctgcttccgcggcgtggactgcatggaggtgtatgagtaccccggctaccgctgc
gggccctgcccccccggcctgcagggaaatggcacccactgcagcgacatcaatgagtgt
gcccacgcggacccttgttttcctggtgtcagctgcatcaacaccatgcccggcttccgc
tgtgaggcctgtccccagggctacaaaggcacgcgggtgtccggtgtgggtattgactac
gcccgcgccagcaaacaggtctgccaggacatcgacgaatgcagtgacggtaacaacggt
ggctgcgaccccaactccatctgcaccaacactgtgggttccttcaagtgtggtccctgt
cgcctgggcttcgtgggcaaccagagccagggctgcgtccccgcccgcacctgccacagc
ccagcccacagcccctgccacgtccacgcgcactgtctctttgaacgcaacggggccgtg
tcctgctcgtgtaacgtgggctgggccgggaacgggaacgtgtgtgggaccgacacggac
atcgacggctacccggaccaggccctgccctgcatggacaacaacaaacattgcaagcag
gacaattgccttttgacccccaactctggccaggaagatgctgataacgatggcgtgggg
gaccagtgcgacgatgatgccgatggcgatgggatcaagaatgtcgaggacaactgccgg
ctcttccccaacaaggaccagcaaaactcagatacagattcattcggggatgcctgtgac
aactgccccaacgttcccaacaatgaccagaaggacacggatggcaatggggaaggggat
gcctgtgacaacgacgtggacggggacggtatccccaacggactggacaattgccctaaa
gtccccaaccccctgcagacagacagggatgaggacggggtgggagatgcgtgtgacagc
tgccctgaaatgagcaatcccactcagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaacgaggacagcgacggggatggacatcaggacaccaaggacaactgccca
cagctgccaaacagctcccagctggactctgacaacgacggccttggagatgagtgtgac
ggggacgatgacaacgacgggatcccagattatgtgcctcctggtcccgacaactgtcgc
ctggttcccaatcccaatcagaaggactcagatggcaatggtgtcggtgacgtgtgtgag
gatgactttgacaatgatgcggtggttgaccccctggacgtgtgtcccgaaagtgcggag
gtgaccctcacggattttcgggcctatcagacggttgtcctggatcctgagggcgatgcc
cagattgacccaaactgggtggtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccccggcctggccgttggatacacagccttcaacggtgtggacttcgaaggcacc
ttccacgtgaacacggtcacagatgacgactacgcaggctttctcttcagctatcaggac
agcggccgcttctacgtggtcatgtggaagcagacggagcagacgtattggcaggccnac
cccttccgggcggtggctcagcccgggctgcagctcaaggcagtgacatccgtgtctggc
ccaggtgaacatctccggaatgccctgtggcacactggccacacccccgaccaggtgcga
ctgctgtggactgacccccggaacgtgggctggcgggacaagacctcctaccgctggcag
ctactgcaccggcctcaagtcggctacattcgggtgaagctctatgagggccctcagctg
gtggcagactccggggtgatcattgacacggccatgcgaggggggcgccttggcgtattc
tgcttctcccaagaaaacatcatttggtccaacctccagtatcgatgcaatgacaccgtg
cccgaggacttcgagccgttccggaggcagctgctccagggaagagcgtga

KEGG   Felis catus (domestic cat): 101100567
Entry
101100567         CDS       T02385                                 
Symbol
THBS2
Name
(RefSeq) thrombospondin-2 isoform X1
  KO
K04659  thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101100567 (THBS2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101100567 (THBS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101100567 (THBS2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100567 (THBS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101100567 (THBS2)
  09174 Infectious disease: parasitic
   05144 Malaria
    101100567 (THBS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100567 (THBS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100567 (THBS2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101100567 (THBS2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101100567 (THBS2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101100567 (THBS2)
  Exosomal proteins of colorectal cancer cells
   101100567 (THBS2)
  Exosomal proteins of bladder cancer cells
   101100567 (THBS2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101100567 (THBS2)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA EGF cEGF TSP1_ADAMTS Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 101100567
NCBI-ProteinID: XP_006932208
Ensembl: ENSFCAG00000002420
UniProt: A0A2I2UG29
LinkDB
Position
B2:complement(154196974..154221823)
AA seq 1172 aa
MLWDLVLLALWAASGARAGDQDEDTAFNLFSISNINRKTIGAKQFRGPDPNVPAYRFVRF
DYIPPVSADYLSKIAKIVRQKEGFFLTASLKQDPKSRGTLLALEGPGASQRQFEIVSNGP
ADTLDLTYWIDGAQHVISLEDVGLADSQWKNITVQVTGETYSLYVGCDLIDSFTLDEPFY
EQLRTEKSRMYVAKGSARDNHFRGLLQNIYLVFENSVEDVLSKKGCQQSQGAEANAISEN
TETLHLSPQVATEYAGPGAHRRPEVCERSCEELGTMITELSGLHVIVNQLHENLRKVSND
NQVLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPATC
ANPSFVEGECCPSCFHSLDGEEGWSPWAEWTQCSATCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKGCQGTPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVQER
QMCNKRSCPVDGCLSNPCFPGAECSSFPDGSWSCGACPVGFLGNGTHCEDLDECAVVTDV
CFAVGKAQRCVNTNPGFHCLPCPPRYKGTQPFGVGLEAARTEKQVCEPENPCKDKTHACH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCSTNATYHCIKDNC
PLLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDIDNDLVGDQCDNNDDIDDDGHQNNQDNCPYIPNANQADHDHDGQGDACDSDD
DNDGVPDDRDNCRLVSNPGQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENSAISETDFR
NFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEEQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTQGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgctctgggatctggtcctgctcgccctctgggccgcgtccggcgcgcgagctggcgac
caggacgaggacaccgccttcaaccttttcagcatcagcaacataaaccggaagaccatt
ggggccaagcagttccgggggcctgaccccaacgtgccagcgtatcgttttgtccgcttt
gactacatcccacccgtgagcgcagattacctcagcaagattgccaagatcgtgaggcag
aaagagggcttctttctcacggccagcctgaagcaggaccccaagtcccggggcacgctc
ctggctctggagggccccggcgcctcccagaggcagttcgagatcgtgtccaacggcccg
gccgacacgctggacctcacctactggatagacggcgctcagcacgttatctccctggag
gacgtgggcctggctgactcccagtggaagaacatcaccgtgcaggtgacaggggagacc
tacagcttgtacgtgggctgcgacctgatcgacagtttcacgctggacgagcctttctac
gagcagctgcggacagaaaagagcaggatgtacgtggccaaaggctctgctcgagacaat
cacttccggggtttgctgcagaacatctacttagtgttcgaaaactcagtggaagatgtt
ctaagcaagaaaggttgtcagcaaagtcagggagccgaagccaacgccatcagcgagaac
acggagacactgcacctgagccctcaggtggccacggagtacgcgggcccaggcgcgcac
aggaggccggaggtgtgcgaacgctcctgcgaggagctgggcaccatgatcaccgagctg
tcggggctgcacgtcatcgtgaaccagcttcacgagaacctgcggaaagtgtccaatgac
aaccaggtcctctgggagctcatcggcggcccgcccaagaccaggaacatgtccgcctgc
tggcaggacggccgcttcttcgcggaaaatgaaacctgggtggtggacagctgcaccaaa
tgcacctgcaagaaatttaaaaccgtttgccaccaaatcacctgcccgccggcgacctgt
gccaacccgtccttcgtggagggagaatgctgtccttcctgcttccactcactggacggt
gaggagggctggtccccctgggcggagtggacccagtgctctgccacctgcgggtcgggc
acccagcagagagggcggtcgtgtgacgtcaccagcaacacctgcttggggccgtccatc
cagacgcgggcgtgcagcctgggcaagtgtgaccaccgaatccggcaggatgggggctgg
agccactggtcgccgtggtcttcctgctctgtgacctgcggcgtgggcaacatcacccgc
atccggctctgcaactcgcccgtcccccagatggggggcaagaattgcaaggggagtggc
cgggagaccaaaggctgccagggcaccccgtgtccaatcgacggccggtggagcccctgg
tccccatggtcagcctgcacggtcacctgtgccggagggatccgggagcggacgcgcgtc
tgtaacagccccgagccccagcacgggggcaaggactgcgtgggggacgtccaagagcgt
cagatgtgcaataaaaggagctgtcctgtagacggctgcttgtccaacccgtgcttcccc
ggtgccgagtgcagcagctttccagacggctcctggtcctgcggcgcctgccccgtgggc
ttcctgggcaacggcacacactgtgaggacctggacgagtgtgccgtggtcaccgacgtc
tgcttcgccgtgggcaaagcccagcgctgcgtcaacaccaaccccggcttccactgcctg
ccgtgcccccctcgctacaaagggacccagccctttggcgtcggcctggaggcggccagg
acggagaagcaggtgtgtgagcctgagaacccgtgcaaagacaagactcacgcctgccac
aagcacgcggagtgcatctacctgggacacttcagcgaccccatgtacaagtgtgagtgc
cagacgggctacgcgggagacgggctcatctgcggggaggactcggacctggacggctgg
cccaacaagaacctggtgtgctccaccaatgccacctaccactgcatcaaggacaactgc
cccctgctgccgaattccgggcaagaagactttgacaaggacggcaccggtgacgcctgt
gacgatgatgacgacaatgacggcgtggacgatgagaaggacaactgccagcttctcttc
aacccccgccagttcgactatgacaaagatgaagtcggggaccgctgtgacaactgcccg
tatgtgcacaacccggcgcagatcgacacggacaacaacggcgagggcgacgcgtgctcc
gtggacattgacggagacgacgtcttcaacgagcgggacaattgtccctacgtctataac
accgaccagagagacacagacggggatggcgtgggcgatcactgcgacaactgccccctg
gtgcacaaccctgatcagaccgacatagacaacgacctcgtgggagaccagtgtgacaac
aatgatgacatcgacgacgatggccaccagaacaaccaagacaactgcccctacatcccc
aacgccaaccaggccgaccacgaccacgacggccagggcgacgcctgtgactcagacgat
gacaacgacggggtcccagacgacagggacaactgccggcttgtctccaaccctggccag
gaggactccgatggggacgggcgtggggacgcttgcaaagacgactttgataacgacagc
atcccagacatcgatgacgtgtgtcctgagaacagcgccatcagcgagaccgacttcagg
aacttccagatggtccacctggacccgaagggcaccactcagatcgaccccaactgggtc
attcgccatcagggcaaggagctggtgcagacggccaactcggaccccggcatcgctgtc
ggttttgacgagttcgggtccgtggacttcagcggcacgttctacgtcaacaccgaccgg
gacgatgactacgccggctttgtcttcggctaccagtccagcagccgcttctacgtggtc
atgtggaagcaggtcacccagacctactgggaagagcagcccactcgggcttacggctac
tcgggcgtgtccctcaaggtggtgaactccaccacgggcaccggcgagcacctgaggaac
gcgctctggcataccgggaacacgcaaggccaggtgcgcacgttatggcacgaccccaaa
aacattggctggaaggactacactgcttacaggtggcatctgacccacagaccgaagacg
ggctacataagagtcttagtgcatgaaggaaaacaggtcatggcggactcgggacccatc
tatgaccaaacgtatgccggcgggcggctgggtctgtttgtgttctcgcaggaaatggtc
tatttctcagacctcaaatacgaatgccgagatgtctaa

DBGET integrated database retrieval system