KEGG   Felis catus (domestic cat): 101087275
Entry
101087275         CDS       T02385                                 
Symbol
CCL21
Name
(RefSeq) C-C motif chemokine 21
  KO
K16062  C-C motif chemokine 21
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101087275 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101087275 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101087275 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101087275 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101087275 (CCL21)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101087275 (CCL21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101087275
NCBI-ProteinID: XP_003995636
Ensembl: ENSFCAG00000003163
UniProt: M3VZU3
LinkDB
Position
D4:complement(58520649..58521798)
AA seq 134 aa
MAQSLALSLLVLVLAFCIPWTQGSDGGAQDCCLKYSLRKIPARIVRSYRKQEPSRGCPIS
AILFSTQKRSQPELCADPKETWVQQLMQRLDKPPAPQKQVQGCKRDKGAPKSGKKGKGSK
GCKRTEQPQTPKGS
NT seq 405 nt   +upstreamnt  +downstreamnt
atggctcagtcattggctctgagcctccttgtcctggtcctggccttctgcatcccctgg
acccaaggcagtgatggaggggcgcaggattgttgcctcaagtacagcctaaggaagatt
cccgcccggattgtccgcagctaccggaagcaggagccaagcaggggctgccccatctca
gctatcctgttctcaactcagaagcgctctcagccagagctatgcgcagaccctaaagag
acctgggtgcagcagctgatgcaacgtctggacaagccaccagccccacagaaacaagtc
cagggctgtaagagggacaaaggagcccccaagtctggcaagaagggaaagggctccaaa
ggctgtaagaggactgaacagccacagaccccaaaagggtcatag

DBGET integrated database retrieval system