KEGG   Felis catus (domestic cat): 101087310
Entry
101087310         CDS       T02385                                 
Symbol
PRNP
Name
(RefSeq) major prion protein
  KO
K05634  prion protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04216  Ferroptosis
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101087310 (PRNP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    101087310 (PRNP)
   05022 Pathways of neurodegeneration - multiple diseases
    101087310 (PRNP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087310 (PRNP)
   04090 CD molecules [BR:fca04090]
    101087310 (PRNP)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101087310 (PRNP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101087310 (PRNP)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101087310 (PRNP)
CD molecules [BR:fca04090]
 Proteins
  101087310 (PRNP)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Others
   101087310 (PRNP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Others
  101087310 (PRNP)
SSDB
Motif
Pfam: Prion Prion_bPrPp Glt_symporter
Other DBs
NCBI-GeneID: 101087310
NCBI-ProteinID: XP_019682354
UniProt: B2LVH2
LinkDB
Position
A3:31428549..31444565
AA seq 260 aa
MVKGHIGGWILVLFVATWSDVGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGW
GQPHAGGGWGQPHAGGGWGQPHAGGGWGQPHAGGGWGQGGGTHGQWGKPSKPKTNMKHMA
GAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYSNQN
NFVHDCVNITVRQHTVTTTTKGENFTETDMKIMERVVEQMCVTQYQKESEAYYQRGASAI
LFSPPPVILLLSLLILLIGG
NT seq 783 nt   +upstreamnt  +downstreamnt
atggtgaaaggccacataggcggctggatcctggttctgtttgtggccacatggagtgac
gtgggcctctgcaagaagcggccgaagcctggtggaggatggaacactggggggagccgg
tacccggggcagggcagtcctggaggcaaccgttacccaccccagggcggtggcggctgg
ggtcagccccacgccggcggcggctggggtcagccccacgccggcggaggctggggtcag
ccccacgccggcggtggctggggtcagccccacgccggcggcggctggggtcaaggtggt
ggcacccacggtcagtggggcaaacccagtaagccgaaaaccaacatgaagcacatggcc
ggagccgcggcagccggggcggtagtggggggcctcggcggctacatgctggggagtgcc
atgagccggcccctcattcattttggcaacgactacgaggaccgttactaccgtgaaaac
atgtaccgctaccccaaccaagtgtactacaggccagtggatcagtacagcaaccagaac
aactttgtgcacgactgcgtcaacatcacggtcaggcagcacacggtcaccaccaccacc
aagggggagaacttcacggagaccgacatgaagataatggagcgcgtggtggagcagatg
tgcgtcacccagtaccagaaagagtccgaggcctactaccaaagaggggcgagcgccatc
ctcttctccccgcctcccgtgattctcctcctctcgctcctcatcctcctgattgggggt
tga

DBGET integrated database retrieval system