KEGG   Felis catus (domestic cat): 101087362
Entry
101087362         CDS       T02385                                 
Symbol
CACNA1B
Name
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B isoform X1
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04721  Synaptic vesicle cycle
fca04723  Retrograde endocannabinoid signaling
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04930  Type II diabetes mellitus
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05032  Morphine addiction
fca05033  Nicotine addiction
fca05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101087362 (CACNA1B)
   04020 Calcium signaling pathway
    101087362 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101087362 (CACNA1B)
   04725 Cholinergic synapse
    101087362 (CACNA1B)
   04728 Dopaminergic synapse
    101087362 (CACNA1B)
   04726 Serotonergic synapse
    101087362 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    101087362 (CACNA1B)
   04721 Synaptic vesicle cycle
    101087362 (CACNA1B)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    101087362 (CACNA1B)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101087362 (CACNA1B)
   05020 Prion disease
    101087362 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    101087362 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    101087362 (CACNA1B)
   05033 Nicotine addiction
    101087362 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101087362 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101087362 (CACNA1B)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101087362 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 101087362
NCBI-ProteinID: XP_023098921
LinkDB
Position
D4:96272074..96464188
AA seq 2353 aa
MVRFGDELGSRYGGAGGERARGGGAGGAGGPGPGGLQPGQRVLYKQSIAQRARTMALYNP
IPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPDG
DKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILAT
AGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYMGKFHKACFPNSTDPEPVGDFPCGKEAPARLCEGDTECREYWPGPNFGITNFDNIL
FAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAK
ERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDAVLKRAA
TKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVK
AQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWSSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAAAFVKHTRGAASHSSSVSSINSPRP
QNSAKARSVWEQRASQLRLQNLRASCEALYSEMDPEERLRYATTRHLRPDMKTHLDRPLV
VELGRDGPRGPPGGKARPEGAEASEGTDPPRRHHRHRDKAPAAAPAAAAEQDRADAPKAE
GGESGAREERARPHRSRSKEARSERGRGPGPEGGRRHHRRGSPEEAAEREPRRHRAHRHA
PDQGKEGAAPGTKGERRARHRGGPRAGPREAGSGEEPARRHRARHKALPTHEDAEKEGEV
EDRDKEKELRNHQPKEPRCDLEASEMMGVGPVHALPSTCLQKVEEQPEDADNQRNVTRMG
SQPSDLSATVHIPVTLTGPPGETTVVPSGNVDLESQAEGKKEVEADDVMRSGPRPIVPYS
SMFCLSPTNLLRRFCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSPRNNALKYMDY
IFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSSFMGGSKGKDI
NTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILVVYMLFMFIFAVIAVQLF
KGKFFYCTDESKGLERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTG
EGWPMVLKHSVDATYEEQGPSPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGD
KVMSECSLEKNERACIDFAISAKPLTRYMPQDKQSFQYKTWTFVVSPPFEYFIMAMIALN
TVVLMMKFYNAPYEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNVFDFVTVL
GSITDILVTEIAETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCL
LIAMLFFIYAIIGMQVFGNIALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSC
LSNQACDEHANANECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPH
HLDEFIRVWAEYDPAACGRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISN
EDMTVHFTSTLMALIRTALEIKLAPAGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPH
KPDEMTVGKVYAALMIFDFYKQNKTTRDQIHQATGGLSQMGPVSLFHPLKATLEQTQPAV
LRGARVFLRQKSSASLSNGGAVQTQESGIKESVSWGTQRTQEVPYEARTPLERGHSTEIP
AVHPGKPAVDVQMQSMALRGPDGEPQPGLESQGRAASMPRLAAETQPAPDASPMKRSIST
LAPQRPHVAHLCNAALDRAPASQAVPHHHHRCHRRRDRKQKSLEKGPSLSADADGAPSSA
AGPGPPPGEGPTGCRRERRQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPLQPKPSLS
SHPTSPTAGQEPGPPRQGGGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSVTYKTA
NSSPVHFAGAQTSLPTFSPGRLSRGLSEHNALLQRDPLSQPLAAGSRIGSDPYLGQRLDS
EDTVRAQPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRV
RHSYHHPDQDHWC
NT seq 7062 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctgggcagccgctatgggggcgccggtggggagcgggct
cggggcggcggggccggcggggcgggcggcccgggccccggggggctgcagccgggccag
cgggtcctctacaagcagtcgatcgcgcagcgcgcgcggactatggcgctctacaacccc
atcccggtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgaggac
aacgtcgtccgcaaatacgccaagcgcatcaccgagtggcctccatttgaatacatgatc
ttggccaccatcatcgccaactgtattgtgctggcactggagcagcacctgcctgacggg
gacaagacacccatgtctgagcggctggatgacacggagccctacttcattggcatcttc
tgctttgaggcggggatcaagatcatagccctgggctttgtcttccacaagggctcctac
ttgcggaacggctggaacgtcatggactttgtggtggttctcacagggatcctggccaca
gcgggcactgacttcgacctgcggaccctgcgggctgtgcgtgtgctcaggcccctgaag
ctggtgtctgggattccgagtctgcaggtggtgctcaagtccataatgaaggccatggtc
ccgcttctgcagattgggttgcttctcttctttgccatcctcatgtttgccatcattggc
ctcgagttctacatgggaaaattccacaaggcctgtttccccaacagcacagatccagag
ccagtgggtgactttccctgtggcaaggaggccccagcccggttgtgtgagggcgacacc
gagtgccgggagtactggccgggacccaactttggcatcaccaactttgacaatatcctg
tttgccatcttgacagtgttccagtgcatcaccatggagggatggactgacatcctttat
aacacaaatgatgcagccggcaacacctggaactggctctacttcatccctctcatcatc
atcggctccttcttcatgctcaacctggtgttgggtgtgctctcaggagagtttgccaag
gagcgtgagagggtcgagaaccgccgggccttcctgaagctccgccggcagcagcagatt
gagcgggagctcaatgggtacctggaatggatcttcaaggctgaggaagtcatgctggcc
gaggaggacaagaatgcggaggagaagtcccctctggatgcagtgttgaagagagcagcc
accaagaagagccggaatgacctgatccatgctgaggagggggaggaccggtttgcagac
ctctgtgctgttggatcccccttcgcccgcgccagcctcaagagtgggaagacagagagt
tcgtcatacttccgtaggaaggagaagatgttccggttcttcatccgccgcatggtgaag
gcacagagcttctactgggtggtgctgtgtgtggtggccctgaatacgctgtgcgtggcc
atggttcactacaaccagccgcagcggctcaccacggcgctgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctggggcccagaagc
tacttccggtcctcattcaactgcttcgactttggggtcattgtggggagcatctttgaa
gtggtctgggccgccatcaagccgggaacctccttcgggatcagcgtgctgcgggcactc
cggttgctgcggatcttcaaagtcacaaagtactggagctccctgcggaacctggtggtg
tctctgctcaactccatgaagtctatcatcagcctccttttcctgttgttcctgttcatc
gtggtctttgccctgctgggcatgcagctgttcgggggacagttcaactttcaagatgag
accccgacaaccaactttgacaccttccccgcggccatccttaccgtcttccagatccta
acaggagaggactggaatgcagtgatgtatcatgggatcgaatcgcaaggtggagtcagc
aaaggcatgttctcctctttttatttcattgtcctgacgctgtttggaaattacactctg
ctgaatgtcttcctggccatcgccgtggacaacctcgccaacgctcaggagctgaccaag
gatgaagaggagatggaagaagcagccaaccagaagcttgctctgcaaaaggccaaagaa
gtggctgaagtgagccccatgtctgccgcaaacatctctattgctgctgcttttgtaaag
cacacgcgaggtgctgcatctcacagctcatctgtctccagcataaactcacccaggccg
cagaactcggccaaagcacgctcggtctgggagcagagggccagccagctgcggctgcag
aacctgcgggccagctgcgaggcgctgtacagcgagatggacccggaggagcggctgcgc
tacgccaccacgcgccacctgcggccggacatgaagacgcacctggaccggccgctcgtg
gtggagctgggccgcgacgggccgcggggccccccagggggcaaggcccggcccgagggc
gcagaggccagcgagggcacggacccaccccgcaggcaccaccggcaccgcgacaaggcc
ccggcagcggccccggcggcggcggcggagcaggacagggcagacgccccgaaggccgag
ggcggggagtccggggcccgggaggagcgggcgcggccgcaccgcagccgcagcaaggag
gcccggagcgagcgcggccgcggcccgggccccgagggcggccggcgccaccaccggcgc
ggctccccggaggaggcggccgagcgggagccccggcgccaccgcgcccaccggcacgca
cccgaccagggcaaggagggcgccgcgcccgggaccaagggagagcggcgagcgcgccac
cgcggcggcccccgggccggcccccgggaggccggcagcggcgaggagccggcgcggcgg
caccgggcccggcacaaggcgctgcccacgcacgaggacgcggagaaggagggcgaggtc
gaggacagggacaaggagaaggagctccggaaccatcagcccaaggagccacgctgtgac
ctggaggccagtgagatgatgggtgtgggccctgtacatgcactgcccagcacctgccta
cagaaggtggaggaacagccggaagatgcagacaatcagcggaatgtcacacggatgggc
agtcaaccctcggacctgagtgccactgtgcatatcccggtgacgctgaccggccctcct
ggggagaccacggttgttcccagtggtaatgtggacctggaaagccaagctgaagggaag
aaggaggtagaagccgatgacgtgatgaggagtggcccccgacctatcgtcccatacagc
tccatgttctgcttaagccccaccaacctgctccgccgcttctgccattacatcgtgacc
atgcggtactttgagatggtcattcttgtggtcatcgccctgagcagcattgccctggca
gccgaggatcctgtgcggacagactcgcccaggaacaacgctctgaaatacatggactac
attttcacaggcgtctttacctttgagatggtgataaagatgattgatttgggactgctg
ctgcaccctggggcctacttccgggacctgtggaatattctggacttcatcgtggtcagt
ggggccttggtggcatttgccttctcgagcttcatgggaggatccaaagggaaagacatc
aacaccatcaagtccctgagagtcctgcgtgtcctgcggcccctcaagaccataaaacgg
ctgcctaagcttaaggccgtgtttgactgtgtggtgaactccctgaagaacgtccttaac
atcctggttgtctatatgctcttcatgttcatatttgctgtcatcgcggtgcagctcttc
aaagggaagtttttctactgcacggatgagtccaaggggctggagagggactgccggggt
cagtatttggattatgagaaggaggaagtggaagctcaaccacggcagtggaagaaatac
gattttcactatgacaatgtgctctgggctctgctgacactgttcacagtgtccacggga
gaagggtggcccatggtcctgaaacactctgtggatgccacctatgaggagcagggccca
agccccgggtaccgcatggagctatccatcttctatgtggtctactttgtggtcttcccc
ttcttcttcgtcaatatctttgtggccttgattatcatcaccttccaggagcagggggac
aaggtgatgtctgagtgcagcctggagaagaacgagagggcttgcattgactttgccatc
agcgccaagcccctgacacggtacatgccccaggacaagcagtcattccagtacaagaca
tggacgtttgttgtgtctccgccctttgagtacttcatcatggccatgattgccctcaac
acggtggtgctgatgatgaagttctacaatgcaccctatgagtacgagctgatgttgaaa
tgcctgaacattgtgttcacatccatgttctccatggaatgcgtgctgaagatcatcgcc
tttggggtgctgaactatttcagagatgcctggaatgtctttgactttgtcactgtgttg
ggaagtattactgatattttagtaacagagattgcggaaacgaacaacttcatcaacctc
agcttcctacgcctcttccgtgctgcccggctcatcaaactgctccgccaaggctacacc
atccgcatcctgctgtggaccttcgtccagtccttcaaggccctgccttacgtgtgtctg
ctcatcgccatgcttttcttcatctatgccatcattggcatgcaggtatttggaaatatt
gccctggatgatgacaccagcatcaaccggcacaacaactttcgaacatttttacaagcc
ttgatgctgttgttcaggagtgccactggggaggcctggcacgagatcatgctgtcttgt
ctcagcaaccaggcctgtgatgagcacgccaatgccaatgagtgtgggagcgactttgcc
tacttttacttcgtctccttcatcttcctttgctcctttctgatgttgaacctctttgtg
gccgtgatcatggacaattttgagtaccttacacgggactcttccatcttagggcctcac
catctggacgagttcatccgggtctgggctgagtacgacccggccgcgtgtgggcgcatc
agttacaatgacatgtttgagatgctgaaacacatgtccccgcccctggggctggggaag
aaatgccctgctcgagttgcatacaagcgcctggttcgcatgaacatgcccatctccaat
gaggacatgactgtccacttcacgtccacgctgatggccctcattcggaccgcactggag
atcaagctggctccagctggcacaaagcagcatcagtgtgatgcagagttgaggaaggag
atttcctccgtgtgggccaatctgccccagaagaccctggatttactggtgccacctcat
aaacctgacgagatgacagtggggaaagtctatgcagctctgatgatatttgacttctac
aaacagaacaaaaccaccagagaccagattcaccaggccactggaggcctatcccagatg
ggccctgtgtccctcttccaccctctgaaggccaccctggagcagacacagccggccgtg
ctccgaggagcccgggtgttccttcggcagaagagctctgcgtccctcagcaacggtggg
gcagtacaaacccaagagagtggcatcaaggagtctgtctcctggggcactcagaggacc
caggaggtaccctatgaggcaaggacacccctggagcgtggccactctacagagatcccg
gcggtgcatccaggaaaaccggctgttgatgtccagatgcagagcatggccctgagaggt
cctgacggggagccccaacctgggctggagagtcagggacgagcggcctccatgccccgc
ctggctgcagagacccagccggcccctgacgccagccccatgaagcgctccatctccacg
ctggcgccccagcgcccccatgtggctcatctctgcaacgctgccctggaccgcgcccca
gccagccaggctgtgccccaccaccaccaccgctgccaccgccgcagggacaggaagcag
aagtccctggagaaggggcccagcctgtccgcagacgcagatggcgcacccagcagtgct
gcagggccggggccacccccaggagaggggcccacaggctgccggcgggagcgtaggcag
gagcgtggccggtcccaagagcggaggcagccctcttcctcctcctcggagaagcagcgc
ttctactcctgtgaccgctttgggggccgtgagcccctgcagcccaagccctccctcagc
agccaccccacatcaccgacagccgggcaggagccaggacccccaagacagggtggtggt
tcagtgaatgggagtcccttgttgtcaacatccggtgctagcacccctggccgcggtggg
cggaggcagctcccccagactccgctgaccccccgtcccagtgtcacctacaagacggcc
aactcttcccctgtccacttcgctggggcgcagaccagcctccccaccttctcccctggc
cggcttagccgtggcctttctgaacacaatgccctgctccagagagaccccctcagccag
cctctggctgctggctctcggatcggctccgacccttacctggggcagcgtctggacagt
gaggacactgtccgcgcccagcctgaggacacgctcaccttcgaggaggctgtggccacc
aactcggggcgctcctcccggacttcctatgtgtcctctctgacctcccagtcccacccc
ctccgtcgcgtgcccaatggctaccactgcactctgggactcagctcgggcggccgggtt
cggcacagctaccaccaccccgaccaagaccactggtgctag

KEGG   Felis catus (domestic cat): 101094827
Entry
101094827         CDS       T02385                                 
Symbol
CACNA1A
Name
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04721  Synaptic vesicle cycle
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04742  Taste transduction
fca04930  Type II diabetes mellitus
fca05017  Spinocerebellar ataxia
fca05032  Morphine addiction
fca05033  Nicotine addiction
fca05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101094827 (CACNA1A)
   04020 Calcium signaling pathway
    101094827 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101094827 (CACNA1A)
   04727 GABAergic synapse
    101094827 (CACNA1A)
   04725 Cholinergic synapse
    101094827 (CACNA1A)
   04728 Dopaminergic synapse
    101094827 (CACNA1A)
   04726 Serotonergic synapse
    101094827 (CACNA1A)
   04730 Long-term depression
    101094827 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    101094827 (CACNA1A)
   04721 Synaptic vesicle cycle
    101094827 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    101094827 (CACNA1A)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    101094827 (CACNA1A)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101094827 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    101094827 (CACNA1A)
   05033 Nicotine addiction
    101094827 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101094827 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101094827 (CACNA1A)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101094827 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 101094827
NCBI-ProteinID: XP_023101889
Ensembl: ENSFCAG00000000486
LinkDB
Position
A2:complement(9424084..9706605)
AA seq 2581 aa
MWKASRVPDPMFSPRSYDALHDGGRGPPAADGTAGAPQDARGPRMSGPCPGPPLKRRGGV
VDHRDVILAHQAHKVHSTPQARRKEWEMARFGDEMPARYGGGGSGAAAGVVVGAGGGRGA
GGSRQGGQPGAQRMYKQSMAQRARTMALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKK
ITEWPPFEYMILATIIANCIVLALEQHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKII
ALGFAFHKGSYLRNGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQ
VVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCG
TEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGN
TWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYM
EWISKAEEVILAEDETDGEQRHPFDALRRATIKKSKTDLLNPEEAEDQLADIASVGSPFA
RASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEW
LSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPG
TSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQ
LFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYF
IVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSA
ANMSIAVKEQQRNQKPTKSVWEQRTSEMRKQNLLASREALYSEMDPDERWKASYARHLRP
DMKTHLDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSG
SMGLDPRRPWAGSQEAELSREGPYGRESDHHAREGGLEQPGFWEGEAERAKAGDPHRRHA
HRQGGSRESRSGSPRTGADGEPRRHRAHRRPGEEGAEDKAERRSRHREGSRPARGGEGGE
GDGPEGGERRRRHRHGPPASYEADAARREDRERRHRRRKENQGSGVPVSGPNLSTTRPIQ
QDLGRQDPPLAEDIDNMRNDKLATAGSAGAHDSLGRPGLPQSPSRTGNSTDPGPAPAPPA
VAANPQNAAGRRAPNNPGDPSDPGPPKTPENSLIVTNPSSTQTNSAKTARKPDHTTVDIP
PACPPPLNHTVVQVNKNANPDPLPKKEEEKKEEEEDDPGEDGPKPMPPYSSMFILSTTNP
LRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEM
VIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLR
PLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKE
FEKDCRGKYLLYEKNEVKARDRQWKKYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDA
TFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNER
ACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASV
AYENALRVFNIVFTSLFSLECLLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGN
PNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIG
MQVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKP
CDKNSGIPTPECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLD
EYVRVWAEYDPAAWGRMPYPDMYQMLRHMSPPLGLGKKCPARVAYKRLLRMDLPVADDNT
VHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTD
LTVGKIYAAMMIMEYYRQSKAKKLQALREEQNRTPLMFQRMEPPSPTQEGGPGQNALPSS
QLDPGGGLLAHESGMKESPSWVTQRAQEMFQKTGTWSPERGPPTDLPNSQPNSQSVEMRE
MGRDGYSDSEHYVPMEGQARAASMPRLPAENQRRRGRPRGNNLSTISDTSPMKRSASVLG
PKARRLDDYSLERVPPEDTQHHHQRRRDRGHRASERSLGRYTDVDTGLGTDLSMTTQSGD
LPSKERDQERGRPKDRKHRQHHHHHHHHHPPPSDKERYAQERPDHGRARARDQRWSRSPS
EGREHMAHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQTPSTPRPHVSYSPVIRKAGGSG
PPQQQQQQQPAARPGRAAPSGPRRYPGPAAEPLAGERPPAGGHGSSRSPAMERRGPGPAR
SESPRACRHGGARWPASEGPPGPRHHGYYRGSDYDEADGPGGGGGEEPRAAAYDAPPPAR
RACSPRTPRAPGPAACASPSRHGRRLPNGYYLAHGPARPRGPGPRRGLHEAYSETDDDDW
C
NT seq 7746 nt   +upstreamnt  +downstreamnt
atgtggaaggcctcccgggtcccggatcccatgttctccccgcgcagttatgacgccctg
cacgacggcggccgggggcccccggcggcggatggcacggccggcgccccgcaggacgca
cggggcccccggatgagcggcccctgccccgggccccctctgaagcggcgcggcggcgtg
gtggaccaccgagatgtcatcttggcccaccaggcgcacaaagtccacagcacgccgcag
gcccggaggaaggaatgggaaatggcccgcttcggagacgagatgccggcccgctacggg
ggaggaggctccggggcagccgccggggtggtcgtgggcgccggaggcgggcgaggagcc
gggggcagccggcagggcgggcagcccggggcgcaaaggatgtacaagcagtcaatggcg
cagagagcgcggaccatggccctctacaaccccatccccgtccgacagaactgcctcacg
gtcaaccggtctctattcctcttcagcgaggacaacgtggtgagaaaatacgccaaaaag
atcaccgaatggcctccctttgaatatatgattttagccaccatcatagcaaactgcatt
gtccttgccctggagcagcacctgcctgacgatgacaagacccccatgtctgaacgactg
gatgacacagaaccatacttcattggaattttttgtttcgaggccggcattaaaatcatc
gccctcgggtttgccttccataaaggctcttacttaaggaatggttggaatgtcatggac
ttcgtggtggtgctaacaggcatattggcgaccgttgggacggagtttgacctacggacc
ctgagggcagtccgagtgctgagaccgctcaagctggtgtctggaatcccaagtttacaa
gtcgtcctgaagtcaatcatgaaggcaatgatccccctgctgcagattggcctcctcctg
ttttttgcaattcttatttttgcaatcatagggttagaattttatatgggaaaatttcat
accacctgctttgaagaggggacagatgacattcagggtgagtctccggctccgtgtggg
accgaggaacccgcccgcacctgccccaatgggaccaaatgtcagccctactgggaaggg
cccaacaatgggatcactcagttcgacaacatcctgtttgcagtgctgactgttttccag
tgcatcaccatggaagggtggactgacctcctctacaacagcaacgatgcctcagggaac
acttggaactggttgtacttcatccccctcatcatcattggctccttttttatgctgaac
ctcgtgctgggtgtgctgtcaggggagtttgccaaagaaagggagcgggtggagaaccgg
cgggcctttctgaaactgaggaggcagcagcagatcgaacgggagctcaacgggtacatg
gagtggatctcaaaagcagaagaggtgatcctcgccgaggatgaaaccgacggggagcag
aggcatccctttgatgctctgcggagagccaccataaagaaaagcaagaccgacctgctc
aaccccgaggaggccgaggaccagctggccgacatcgcctccgtggggtctcccttcgcc
cgagccagcattaaaagtgccaagctggagaactcgaccttttttcacaaaaaggagagg
aggatgcgtttctacatccgccgcatggtcaaaactcaggccttctactggactgtgctc
agtctggtagccctcaacactctgtgtgtcgctattgttcactacaaccagcccgagtgg
ctctccgacttcctctactatgcagaattcattttcttaggactctttatgtccgaaatg
tttataaaaatgtacgggcttgggacgcggccttacttccactcttccttcaactgcttt
gactgtggggttatcatcgggagcatcttcgaggtcatctgggccgtcataaaacccggc
acatcctttggaatcagcgtgttacgagccctcaggttattgcgtattttcaaagtcaca
aagtactgggcatcactcaggaacctggtcgtctctcttctcaactccatgaaatccatc
atcagcctgttgttcctccttttcctgttcatcgtggtcttcgcccttttgggaatgcaa
ctcttcggcggccagtttaacttcgatgaagggactcctcctaccaatttcgacaccttt
ccagcagcaataatgacagtgtttcagatcctgacgggcgaagactggaacgaggtcatg
tatgacggtatcaagtctcaggggggcgtgcagggcggcatggtcttctccatctacttc
atcgtgctgacgctcttcgggaactacaccctcctgaacgtgttcttagccatcgcggtg
gataatttggccaacgcccaggagctcaccaaggatgaacaagaagaagaagaggcagcc
aaccagaagctggccctgcagaaagccaaggaggtggcagaagtgagtcccctgtcagcc
gccaacatgtccatagctgtgaaggagcagcagaggaaccagaaacccaccaagtcggtg
tgggagcagcgcaccagcgagatgcggaagcagaacttgctggccagccgggaggcgctg
tacagcgagatggacccggacgagcgctggaaggcctcgtacgcccggcatctgcggccg
gacatgaagacccacctggaccggccgctggtggtcgacccccaggagaaccgcaacaac
aacaccaacaagagccgggcggccgagcccaccgtggaccagcgcctcggccagcagcga
gccgaggacttcctcaggaaacaggcccgctaccacgaccgggcccgggaccccagcggc
tccatgggcctggacccccgcaggccctgggccggcagccaggaggccgagctgagccgg
gaggggccttacggccgcgagtcggaccaccacgcgcgggagggcggcctggagcagccg
ggcttctgggagggcgaggccgagcgggccaaggccggggacccccaccggaggcacgcc
caccggcaggggggcagcagggagagccgcagcggctcgccccgcacgggggccgacggc
gagccgcgccggcaccgggcccaccgccggccgggcgaggagggcgcggaggacaaggcg
gagcggaggtcccggcaccgcgagggcagccggccggcccggggcggcgagggcggcgag
ggcgacgggcccgagggcggcgagcggaggaggcggcaccggcacggccccccggcctcc
tacgaggcggacgcagcgcgcagggaggaccgagagcgccgccaccggaggaggaaagag
aaccagggctccggggtccccgtgtcgggccccaacctgtcgaccacccggccaatccag
caggacttgggccgccaggacccaccgctggccgaggacattgacaacatgaggaacgac
aagctggccaccgcggggtcggccggcgcccacgacagcctcggccgccccggcctgccc
cagagcccctccaggaccggaaacagcaccgaccccggccccgcgccagcaccgcccgcc
gtggccgcgaacccccagaacgccgccgggcgccgggcgcccaacaacccgggggacccg
tccgaccccggcccccccaagacccccgagaacagccttatcgtcaccaaccccagcagc
acacagaccaactcagcaaagactgccaggaaacccgaccacaccacggtggacatcccc
ccggcctgcccgccccccctcaaccacaccgtcgtccaagtgaacaaaaacgccaaccca
gacccactgccaaaaaaggaggaagagaagaaggaggaggaggaagacgaccctggggaa
gacggccccaagcccatgcccccctacagctctatgtttatcctctctacaaccaacccc
cttcgccgcctgtgccactacatcctgaacctgcgctactttgagatgtgcatcctcatg
gtcattgccatgagcagcatcgccctggcggctgaggatcccgtgcagcccaacgcaccg
cgaaacaacgtgctacggtattttgactacgtttttacaggcgtctttacctttgagatg
gtgatcaagatgatcgacctggggctcgtcctgcaccagggtgcctacttccgcgacctc
tggaacattctcgacttcatagtggtcagtggggccctggtggcctttgccttcactggc
aacagcaaaggaaaggacatcaacacaattaagtccctccgagtcctccgggtgctacga
cctcttaaaaccatcaagcggttgccaaagctcaaggccgtgttcgactgcgtggtgaac
tcgctcaagaacgtcttcaacatcctcatcgtctacatgctgttcatgttcatcttcgcc
gtggtggccgtgcagctgttcaaggggaagttcttccactgcaccgacgaatccaaggag
tttgagaaagactgtcgcggcaagtacctcctatacgagaagaacgaggtgaaggcccgg
gacaggcagtggaagaagtatgagttccattatgacaacgtgctctgggctctgttgact
ctcttcaccgtgtccacgggagaaggctggccacaggtcctcaagcactccgtggacgcc
acctttgagaaccagggccccagccccgggtaccgcatggagatgtccatcttctacgtc
gtctacttcgtggtgttccccttcttcttcgtcaatatcttcgtggccttgatcatcatc
accttccaggagcagggggacaagatgatggaggaatacagcctggagaaaaatgagagg
gcctgcatcgacttcgccatcagtgccaaaccgctgacccgacacatgccgcagaacaag
caaagcttccagtatcgcatgtggcagttcgtggtgtccccgcctttcgagtacaccatc
atggccatgatcgccctcaacaccatcgtgctcatgatgaagttctacggggcctcggtt
gcttatgaaaacgctttgagggtattcaacatcgtcttcacctccctcttctctctggaa
tgtctgctgaaagtcatggctttcgggattctgaattactttcgtgatgcctggaacatc
ttcgactttgtgactgttctgggcagcatcaccgacatcctcgtgactgagtttgggaat
ccgaataacttcatcaacttgagttttctccgcctcttccgagctgcccggctcatcaaa
ctcctccgacagggttacaccatccgaatcctcctctggacctttgtgcagtccttcaag
gccttgccttatgtctgtctgctgattgccatgcttttctttatctacgccatcatcggg
atgcaggtgtttggcaacatcggcatcgacgtggaggatgaggacagtgatgaggatgag
ttccaaatcactgagcacaataactttcggaccttcttccaggccctcatgcttctcttc
aggagtgccaccggggaggcttggcacaacatcatgctttcctgcctcagtgggaagccg
tgtgataagaactctggcatcccgactcccgagtgtggcaatgaatttgcttacttctac
ttcgtttccttcatcttcctgtgttcatttctgatgctgaacctctttgtcgctgtcatc
atggacaactttgagtacctcacccgagattcctccatcctgggcccccaccacctggat
gagtacgtgcgtgtctgggccgagtacgaccccgcagcgtggggccgcatgccttacccg
gacatgtatcagatgctgagacacatgtctccgcccctgggtctggggaagaagtgtccg
gccagagtggcttacaagaggctccttcgcatggatctgcccgtggccgatgacaacact
gtccacttcaattctaccctcatggccctgatccgcacagccctggacatcaagatcgcc
aagggcggggccgacaagcagcaaatggacgctgagctgaggaaggagatgatggccatc
tggcccaacctgtcccagaagacgctcgacctgctggtcacccctcacaagtccacagac
ctgaccgtggggaagatctacgcggccatgatgattatggaatactaccggcaaagcaag
gccaagaagctgcaggccctgcgtgaggagcagaatcggacaccgctcatgttccagcgc
atggagcccccgtccccaacccaggaggggggccctggccagaacgccctcccgtcctcc
cagctggacccaggaggaggcctgttggctcacgaaagcggcatgaaggagagcccgtcc
tgggtgacccagcgggcccaggagatgttccagaagaccggaacgtggagcccagagcgg
gggcctcccaccgacctgcccaacagccagcccaactcccagtctgtggagatgcgagag
atgggcagagacggctactcagacagcgagcactacgtccccatggaaggccaggcccgg
gcggcctccatgccccgcctccccgcggaaaaccagaggagaaggggccggccacgtggg
aataacctcagtaccatctcagacaccagccccatgaagcgctcagcctccgtgctgggc
cccaaggcccggcgcctggacgattactccctggagagggtgccgcctgaagacacccag
caccaccaccagcggcgccgagaccgcggccaccgagcctctgagcgctccctgggccgc
tacacggacgtggacacaggcttggggaccgacctgagcatgaccacccagtccggggac
ctgccgtctaaggagcgggaccaggagcggggccggcccaaggaccggaagcaccggcaa
caccatcaccaccaccaccaccaccaccccccaccctcggacaaggaacgctacgcccaa
gagcggcctgaccatggccgggcccgggcccgggaccagcgctggtcccgctcgcccagc
gagggccgtgaacacatggcacaccggcagggcagtagttccgtaagtggaagcccagcc
ccctcaacatctggtaccagcactccgcggcggggacgccgccagctcccccagaccccc
tccaccccccggccacacgtgtcctattcccccgtgatccgtaaggccggcggctcgggt
cccccgcagcagcagcagcaacagcagccggcggcgcggccgggccgggcggcccccagc
ggcccgcggaggtacccgggccccgcggccgagcctctggccggggagcggccgcccgcg
gggggccacggcagcagccgctcgcccgcgatggagcggcggggcccgggcccggcccgg
agcgagtcccccagggcgtgtcgccacggcggggcgcggtggccggcgtccgaggggccc
cccgggccccggcaccacggctactaccggggctccgactacgacgaggccgacggcccg
ggcggcggaggaggggaggagccccgggccgcggcttacgacgcgccaccccccgcgcga
cgcgcgtgctcgcccaggactccccgggccccgggcccggcggcgtgcgcctcgccttcc
cggcacggccggcgactccccaacggctactacctggcgcacggaccggccaggccgcgc
gggccgggcccccggagaggcctgcacgaagcctacagcgagaccgacgacgacgactgg
tgctaa

DBGET integrated database retrieval system