KEGG   Felis catus (domestic cat): 101087520
Entry
101087520         CDS       T02385                                 
Symbol
RHOG
Name
(RefSeq) rho-related GTP-binding protein RhoG
  KO
K07863  Ras homolog gene family, member G
Organism
fca  Felis catus (domestic cat)
Pathway
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101087520 (RHOG)
   05135 Yersinia infection
    101087520 (RHOG)
   05100 Bacterial invasion of epithelial cells
    101087520 (RHOG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087520 (RHOG)
   04031 GTP-binding proteins [BR:fca04031]
    101087520 (RHOG)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087520 (RHOG)
  Exosomal proteins of other body fluids (saliva and urine)
   101087520 (RHOG)
  Exosomal proteins of colorectal cancer cells
   101087520 (RHOG)
  Exosomal proteins of bladder cancer cells
   101087520 (RHOG)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101087520 (RHOG)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA
Other DBs
NCBI-GeneID: 101087520
NCBI-ProteinID: XP_023095255
LinkDB
Position
D1:complement(62027780..62039317)
AA seq 191 aa
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagagcatcaagtgtgtggtggtgggcgatggggctgtgggcaagacgtgcctgctc
atctgctacacgactaatgccttccccaaggaatacatccccacagtgttcgacaattac
agtgcccagagtgcggttgacgggcgcacagtgaacctgaacctgtgggacacagcgggc
caggaggagtatgaccgactccgcacactctcctaccctcagaccaatgtctttgtcatc
tgtttctccattgccagtccgccctcctacgagaatgtgcggcacaagtggcatccggaa
gtgtgccaccactgccccgacgtgcccatcctcctggtgggcaccaagaaggacctgaga
gcccagcctgacaccctacggcgccttaaggagcagggccaggcgcccatcacaccgcag
cagggccaggccttggccaagcagatccatgctgtgcgctacctcgagtgctcagccctg
cagcaggacggcgtcaaggaagtgtttgctgaggctgtccgggctgtgctcaaccccacg
cccatcaagcgtgggcggtcctgcgtcctcttgtga

KEGG   Felis catus (domestic cat): 101093337
Entry
101093337         CDS       T02385                                 
Name
(RefSeq) rho-related GTP-binding protein RhoG-like
  KO
K07863  Ras homolog gene family, member G
Organism
fca  Felis catus (domestic cat)
Pathway
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101093337
   05135 Yersinia infection
    101093337
   05100 Bacterial invasion of epithelial cells
    101093337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093337
   04031 GTP-binding proteins [BR:fca04031]
    101093337
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101093337
  Exosomal proteins of other body fluids (saliva and urine)
   101093337
  Exosomal proteins of colorectal cancer cells
   101093337
  Exosomal proteins of bladder cancer cells
   101093337
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101093337
SSDB
Motif
Pfam: Ras Roc Arf AAA_7 GTP_EFTU
Other DBs
NCBI-GeneID: 101093337
NCBI-ProteinID: XP_006943879
LinkDB
Position
X:60610458..60619149
AA seq 200 aa
MDSADSKGRMQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQTSVDGQIV
SLNLWDTAGQEEYDRLRTLSYPQTNIFVICFSIGNPSSYANVRHKWHPEVSHHCPNVPVL
LVGTKRDLRNDIETVKKLKEQSLVPTTPQQGTSLAKQVGAVKYLECSALMQDGVHEVFSE
AVRAVLYPATKKNTKKCVLL
NT seq 603 nt   +upstreamnt  +downstreamnt
atggactccgcggactccaagggaagaatgcagacaatcaaatgtgtggtcgtaggtgat
ggggctgtaggtaagacctgcctcctcatcagttacacaacaaatgcttttcctgaagag
tatatccccaccgtctttgacaactacagtgcccagacatctgtggacggccaaattgtc
agcctgaacctgtgggacacagctggccaagaggagtatgaccgactgcgaacgctgtcc
tacccccagaccaatatctttgtcatttgtttttctattggtaacccatcgtcgtatgcc
aatgtgaggcataagtggcacccagaggtctctcatcattgccccaatgtacctgtcctg
ctggtaggcaccaagagggacctgcggaatgacattgagacagtgaagaagctgaaggaa
cagagcctagtgcccacaactcctcagcaaggcacttccctggctaagcaggtgggggct
gtgaagtatctggaatgttcagccctgatgcaggatggggtccatgaggtattttcagaa
gctgtccgcgctgtgctttaccctgccacaaagaagaacaccaagaagtgtgtcctctta
tag

DBGET integrated database retrieval system