KEGG   Felis catus (domestic cat): 101087550
Entry
101087550         CDS       T02385                                 
Symbol
FCGR2B
Name
(RefSeq) Fc fragment of IgG, low affinity IIb, receptor (CD32)
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04662  B cell receptor signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05162  Measles
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087550 (FCGR2B)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    101087550 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    101087550 (FCGR2B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101087550 (FCGR2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    101087550 (FCGR2B)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101087550 (FCGR2B)
   05152 Tuberculosis
    101087550 (FCGR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087550 (FCGR2B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101087550 (FCGR2B)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    101087550 (FCGR2B)
CD molecules [BR:fca04090]
 Proteins
  101087550 (FCGR2B)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5 EACC1 Protocadherin DUF202 MerC DUF6479 LapA_dom DUF2681
Other DBs
NCBI-GeneID: 101087550
NCBI-ProteinID: NP_001277169
Ensembl: ENSFCAG00000008160
UniProt: S6BBE9
LinkDB
Position
F1:complement(65669328..65684898)
AA seq 297 aa
MQIPSTRPLPAARSDRAECVPCPPLGDMLLWTALLFLGPVLGTPGLPKAVVDLEPPWILV
LREDDVTLKCQGAHTAGDHSIRWFHNGSSIPTQVRPNYSFKATEKDRGEYACQTDQTSLS
DPVYLDVFSDWLVLQTPSLVFQKGEPIVLRCHSWRNKPLYKITFFQNGKSKQFSPTNSTF
SIPRANLSHSGEYHCTGLIGKSLQASQPVAITVQGSSWSDSSVTVMIAVTVAGIAAVAIL
AAVVAWFRHRQKQTSANLTDAEDAAKVEAENAITYSLLLHPEAIEEEAEDPDYQNHI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcagatcccttcaacccgccccctccctgctgcccgtagtgaccgagccgagtgtgtg
ccctgcccccctttgggcgacatgctactgtggacagctctgctcttcttgggtccagtc
cttgggacacctggtctcccgaaggctgtggtggacctggagcccccgtggatcctcgtg
ctccgggaggacgatgtgactctgaagtgccagggggcccacacagccggggaccactcc
atccggtggttccataatgggagctccatccccacgcaggtccggcccaactacagcttt
aaggccaccgagaaggatagaggggagtacgcgtgccagacggaccagaccagcctcagt
gaccccgtgtatctggacgtgttttccgactggctggtgctccagacccctagcctggtg
ttccagaagggggagcccatcgtgctgaggtgccacagctggaggaacaagcctctgtac
aagatcacgttcttccagaatggaaaatccaagcagttttcccccacgaattccaccttc
tccatcccacgggcaaacctcagtcacagcggcgagtaccattgcacaggactgataggg
aagagtctgcaggcgtcacagcccgtggccatcaccgtccaagggtccagttggagcgac
tcctcagtgacggtgatgattgcggtcacggtcgctggcattgctgccgtggccatcctt
gctgccgttgtggcctggttccgccacaggcaaaagcagacttcagccaatctcacggat
gctgaagatgccgccaaagttgaggctgagaatgccatcacctattcacttctcttgcac
ccggaagccatagaggaagaagcagaggacccggattaccagaaccacatttaa

KEGG   Felis catus (domestic cat): 101087936
Entry
101087936         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04613  Neutrophil extracellular trap formation
fca04640  Hematopoietic cell lineage
fca04666  Fc gamma R-mediated phagocytosis
fca05140  Leishmaniasis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087936
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101087936
   04613 Neutrophil extracellular trap formation
    101087936
   04666 Fc gamma R-mediated phagocytosis
    101087936
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101087936
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101087936
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101087936
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101087936
   05152 Tuberculosis
    101087936
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101087936
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101087936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087936
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101087936
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    101087936
CD molecules [BR:fca04090]
 Proteins
  101087936
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set
Other DBs
NCBI-GeneID: 101087936
NCBI-ProteinID: XP_023114869
Ensembl: ENSFCAG00000027331
LinkDB
Position
C1:105064895..105094575
AA seq 374 aa
MWLLTALLLWVPAGAQADLTKAVITLQPPWVSVFQEENITLWCEGPHLPGNSSTRWFLNG
TAFQTLTPRYRIAAASISDTGEYRCQTGLSVPSDPVRLEIHRDWLLLQVQSRVFTEGEPL
TLRCHGWKNKLVYNVVFYQNDKAFKFSPQNSEFTILKTSLSHNGIYHCSGMGRHRYTSPG
VSITVKELFLAPVLKASLSLPLLEGHLVNLSCETKLLLQRPGLQLYFSFYTGSKTLMSRN
TSSGYQILTAKREDSGLYWCEATTEDGSIVKRSPELELQVLGLQTPTPVWFHVLFYLSVG
MIFLVDTILCMIIHKELQKQKQWNLEISLGSGPKKNVTSYLQEDRYLEDLELKCQEPEQL
QERIHQKSLEGGQQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtggctcttgacggctctgcttctttgggttccagctggtgcgcaagcggaccttaca
aaggcagtgatcaccttgcagcctccatgggtcagtgtatttcaagaggaaaacataacc
ttatggtgtgagggaccccatttgcctgggaacagctctacacggtggtttctcaatggc
acagcctttcagaccttgacccccagatacagaatcgctgctgccagtatcagtgacact
ggtgaatacaggtgccagacaggtctctcagtgccaagtgacccagtacggctggaaatc
cacagagattggctactactccaggtccaaagcagagtcttcacagaaggggaacctctg
accttaaggtgtcatggatggaagaataagctggtatacaatgtggttttctaccaaaat
gacaaggcctttaagttttctcctcagaattctgaattcaccattctgaaaaccagcctg
agtcacaatggcatctatcactgctcaggcatgggaaggcatcgctacacatcaccagga
gtctctatcactgtgaaagagctatttctggccccagtgctaaaagcatccttgtcgtta
ccactcctggaggggcatctggtcaacctgagctgtgaaacaaagttgctcctacagaga
cctggtttgcaactttacttctccttctacacgggcagcaagaccctgatgagcaggaac
acatcctctggataccagatactaactgctaaaagagaagattcagggctatactggtgt
gaggctaccacagaagatggcagtattgtcaagcgcagccctgagttggaacttcaagtg
cttggcctccagacaccaactcctgtttggtttcacgtccttttctatctgtcagtggga
atgatatttttggtggacaccattctctgtatgattatacataaggaacttcaaaaacag
aaacagtggaatttagaaatctctttgggctctggtcctaagaaaaatgtaacttcctac
cttcaagaagatagatacttagaagacttagagctgaaatgtcaggaaccagaacagctg
caagaaaggatacaccagaagtccctagagggagggcagcagtag

KEGG   Felis catus (domestic cat): 493677
Entry
493677            CDS       T02385                                 
Symbol
FCGR3A
Name
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III-A precursor
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04666  Fc gamma R-mediated phagocytosis
fca05140  Leishmaniasis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    493677 (FCGR3A)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    493677 (FCGR3A)
   04650 Natural killer cell mediated cytotoxicity
    493677 (FCGR3A)
   04666 Fc gamma R-mediated phagocytosis
    493677 (FCGR3A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    493677 (FCGR3A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    493677 (FCGR3A)
   05152 Tuberculosis
    493677 (FCGR3A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    493677 (FCGR3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    493677 (FCGR3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493677 (FCGR3A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493677 (FCGR3A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    493677 (FCGR3A)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    493677 (FCGR3A)
CD molecules [BR:fca04090]
 Proteins
  493677 (FCGR3A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Receptors
  493677 (FCGR3A)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_4 ig Ig_5 SUR7
Other DBs
NCBI-GeneID: 493677
NCBI-ProteinID: NP_001009205
Ensembl: ENSFCAG00000001034
UniProt: Q9N2I5
LinkDB
Position
F1:65743324..65750699
AA seq 250 aa
MWRLLSPTALLLLVSAGTRAADLSKAMVVLEPEWNRVLVSDGVILKCEGAYPPGDNSAQW
WHNGSVIPHRAPSYSIEAARSEDSGEYKCQTGLSEASDPVQLEVHTGWLLLQAPRWVFQE
GDTIQLRCHSWKNKTVQKVQYFQDGRGKMFFHKNSDFYIPKATSKHSGSYFCRGLIGNKN
ESSEAVNITVQGPPVPSTSTFLPHWYQIAFFLVTALLFVVDTGLHVAVQRDLQSSVKEWK
DGKVTWSHGP
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtggcggctgctgtccccgacagccctgctccttctggtttctgctggcacgcgagct
gcagacctctcgaaggccatggtggtcctagaacctgaatggaacagggtactcgtttcg
gacggtgtgattctgaagtgcgagggggcctacccccctggggacaattccgcacagtgg
tggcacaacgggagcgtcatcccccatcgggcccccagctactccatcgaagctgccaga
agtgaagacagtggcgagtataagtgccagacgggcctctccgaagccagcgacccggtg
cagcttgaagtgcacactggctggctgctgcttcaggccccacgctgggtgttccaggag
ggagacaccatccagctgaggtgccacagctggaagaacaagacggtacagaaggttcaa
tatttccaggacggaaggggcaagatgttttttcataagaattccgacttctacattcca
aaagcaacgagcaaacacagtggctcctacttctgcagggggcttatcgggaataaaaat
gagtcatcagaggctgtgaacatcacggttcaaggtccgccagttccttccacctcaacg
ttccttccacattggtaccaaatcgctttcttcctggtgacagcactcctatttgtagtg
gacacagggctgcatgtggctgtgcagagagaccttcagagctccgtgaaggagtggaag
gacggcaaagtcacgtggagccacggcccgtag

DBGET integrated database retrieval system