KEGG   Felis catus (domestic cat): 101087686
Entry
101087686         CDS       T02385                                 
Symbol
FRAT1
Name
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05200  Pathways in cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101087686 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087686 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101087686 (FRAT1)
   05226 Gastric cancer
    101087686 (FRAT1)
   05224 Breast cancer
    101087686 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087686 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    101087686 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 101087686
NCBI-ProteinID: XP_004001632
LinkDB
Position
D2:58561977..58564472
AA seq 281 aa
MPCRREEEEEAGEEAEGEAEEEEEDSFLLLEQSVTLGGSGEVDLLVAQIGEALQLDAAQD
SPASPCAPPGPPLQPPRPPAAVRADKARPPALPLLLPPAPAEAVGPAPPGALRCALGDRG
RVRGRAAPYFVAELAAGPSALSPLAPHPGFDGPSGANKRGAPQPLSGPCRRGWLRGAAAS
RRLQQRRGTQLESRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPQRPLTGP
LSAPVHEPPSPHSPRAACSDPGASGRRAQLKTGDGVLVPGS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgccgtgtcggagggaggaggaagaggaagccggcgaggaagcggagggggaggcggag
gaggaggaggaggacagcttcctcctgctggagcagtcggtgacgctgggcggctcgggc
gaggtggacctgctggtggcccagatcggcgaggcgctgcagctggacgcggctcaggac
agcccggcctccccgtgcgcgcccccggggccgccgctgcagcccccgcggcccccggcg
gccgtgcgggcggacaaggcccggccccctgcgctgccactgctgctgccgcccgcgccg
gccgaggcggtgggcccggcgcccccgggggccctgcgctgcgccctcggggaccgcggc
cgcgtgcggggccgggctgcgccctacttcgtggccgagctcgccgcaggccccagcgct
ctgtccccactggcccctcatcccggctttgatgggccttcgggagccaacaagcggggc
gccccgcagccgctgtccggcccgtgccggcgaggttggctgcgaggcgccgccgcctcc
cgccgcctacaacagcgacgcgggacccagctcgaatcccgcaccggcgacgacgatccg
caccggctcctgcagcagctggtgctctcggggaacctcatcaaggaggctgtgcggagg
cttcattcgcgacggctgcagttacacgcaaagcttccccagcgcccgctcacggggcct
ctgtcggccccagtgcatgagcccccttcgccccacagccctcgcgcggcctgcagcgac
cccggcgcgtctgggaggagggcgcagctcaaaactggcgacggcgttctggtacctggc
agctaa

KEGG   Felis catus (domestic cat): 105261037
Entry
105261037         CDS       T02385                                 
Symbol
FRAT2
Name
(RefSeq) GSK-3-binding protein FRAT2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05200  Pathways in cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105261037 (FRAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105261037 (FRAT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105261037 (FRAT2)
   05226 Gastric cancer
    105261037 (FRAT2)
   05224 Breast cancer
    105261037 (FRAT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105261037 (FRAT2)
   05022 Pathways of neurodegeneration - multiple diseases
    105261037 (FRAT2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 105261037
NCBI-ProteinID: XP_023096567
LinkDB
Position
D2:complement(58573629..58576224)
AA seq 234 aa
MPCRREEEEEAGEEAEGEAEEEEEDSFLLLEQSVTLGGSGEVDLLVAQIGEALQLDAAQD
SPASPCAPPGPPLQPPRPPAAVRADKARPPALPLLLPPAPAEAVGPAPPGALRCALGDRG
RVRGRAAPYFVAELAAGPSALPGPCRRGWLRGATASRRLQQRRWPPTGTRAREDDPHRLL
QQLVLSGNLIKEAVRRLQRAVAAVAATSPVGAAGPGGGRSGPDPVSLQPSGALH
NT seq 705 nt   +upstreamnt  +downstreamnt
atgccgtgtcggagggaggaggaagaggaagccggcgaggaagcggagggggaggcggag
gaggaggaggaggacagcttcctcctgctggagcagtcggtgacgctgggcggctcgggc
gaggtggacctgctggtggcccagatcggcgaggcgctgcagctggacgcggctcaggac
agcccggcctccccgtgcgcgcccccggggccgccgctgcagcccccgcggcccccggcg
gccgtgcgggcggacaaggcccggccccctgcgctgccactgctgctgccgcccgcgccg
gccgaggcggtgggcccggcgcccccgggggccctgcgctgcgccctcggggaccgcggc
cgcgtgcggggccgggctgcgccctacttcgtggccgagctcgccgcaggccccagcgct
ctgcccgggccgtgccggcgaggttggctgcggggcgccaccgcctcccgccgcctgcag
cagcgacgatggcccccaaccgggacgcgcgcccgcgaagacgacccgcaccggctcctg
cagcagctggtgctctcggggaacctcatcaaggaggccgtgcgaagacttcagcgagcc
gtcgctgccgttgcagccacgagcccagtgggcgccgctgggccgggaggcggccgcagc
ggaccagaccctgtttccctgcagccttctggcgctttgcactga

DBGET integrated database retrieval system