KEGG   Felis catus (domestic cat): 101087822
Entry
101087822         CDS       T02385                                 
Symbol
ATP2B2
Name
(RefSeq) plasma membrane calcium-transporting ATPase 2 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04925  Aldosterone synthesis and secretion
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04972  Pancreatic secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101087822 (ATP2B2)
   04024 cAMP signaling pathway
    101087822 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    101087822 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101087822 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087822 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    101087822 (ATP2B2)
   04972 Pancreatic secretion
    101087822 (ATP2B2)
   04978 Mineral absorption
    101087822 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101087822 (ATP2B2)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101087822 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 EMC3_TMCO1
Other DBs
NCBI-GeneID: 101087822
NCBI-ProteinID: XP_023105776
Ensembl: ENSFCAG00000011247
LinkDB
Position
A2:complement(51491026..51881088)
AA seq 1243 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGENNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQVKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKKGDGLQLPAADGAAGSNAVDSANTSLVNGKMQDGNVDASQSKAKQQDGAAAMEMQ
PLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDT
FVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNL
VRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSINAKTMELLVN
AIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYEPVRTQMPEEKLYKVY
TFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKV
IEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNDLTCICVVGIEDPVRPEVPEAIRKC
QRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDK
IWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIA
GTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACIT
QDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAV
YQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGER
NVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQV
IATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRRGQILWFRGLNRIQTQ
IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLIDDTDLEEDAALKQNS
SPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgatttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcacaatggaggagctccgctccctcatggagctacggggcacc
gaggctgtggtcaagatcaaggagacttatggggacactgaagccatctgccggcgcctc
aagacttcacctgtggaaggtttgccgggcaccgctccagatctggaaaagagaaagcag
atttttgggcaaaactttatacctccaaagaagccaaaaaccttcctgcagctggtgtgg
gaggcactgcaagatgtgacgctgatcatcctggaaatcgcggccatcatctccctgggg
ctgtccttttaccacccgcctggagagaacaatgaaggatgtgcgacggcccagggaggg
gcagaggatgaaggggaggcggaggcgggctggatcgagggggcggccatcctcctctct
gtcatctgtgtggtcctggtcacggccttcaatgactggagcaaagagaagcagttccgg
ggcctgcagagccgcattgagcaggagcagaagttcaccgtggttcgggctggccaggtg
gtccagatccctgtggccgagattgtggttggggacatcgcccaggtcaaatatggtgac
ctcctccctgctgacggcctcttcatccagggcaatgacctcaaaatcgacgaaagctcc
ctgacgggagagtctgaccaggtgcgcaagtccgtggacaaggaccccatgctgctgtca
gggacccacgtgatggagggctctggacggatggtagtgaccgcagtgggtgtgaattct
cagactggcatcatctttaccctgctgggggctggcggtgaggaggaagaaaagaaagac
aagaaaggtgtgaagaagggggatggccttcagctaccagcggccgatggtgcagcaggc
tcaaatgctgtagatagtgcaaataccagcctagtcaatggtaaaatgcaggatggcaat
gtggacgccagccagagcaaagccaaacagcaggacggggcagccgccatggagatgcag
cccctcaagagtgccgagggcggcgatgccgacgacaaaaaaaaggccaacatgcacaag
aaggagaagtctgtgctgcagggaaagctcaccaagctggctgtgcagataggcaaggca
ggactggtgatgtcggccatcacagtgatcatcctggtgctctacttcaccgtggacacc
ttcgtggtcaacaagaagccgtggttacccgagtgcacgcccgtctacgtgcagtacttt
gtcaagttcttcatcatcggcgtgacggtgctggtggtggccgtgcccgaggggctccct
ctggccgtcaccatctcactggcctactctgtgaagaaaatgatgaaagacaacaacctg
gtacgccacctggatgcctgcgagaccatgggcaatgccaccgccatctgctcagacaag
acaggcacactgaccaccaatcgcatgacagtcgtgcaggcctacgtgggtgacgtccac
tacaaggagatccccgaccccagctccatcaacgccaagaccatggagctgctcgtcaac
gccattgccatcaacagcgcctacaccaccaagattctgcccccggagaaggagggtgcc
ctgcctcggcaggtgggcaacaagacagagtgcggcctgctgggcttcgtgctggacctg
aagcaggattatgagcccgtgcgcacccagatgccagaggagaagctgtacaaggtgtac
accttcaactctgtgcgcaagtccatgagcacagtcatcaagctgccggacgagagcttc
cgcatgtacagcaagggtgcttctgagatcgtgctcaagaagtgctgcaaaatcctcaac
ggggcaggggagccccgggtcttccggccccgcgaccgggatgagatggtgaagaaggtg
atcgagcccatggcctgtgatgggctccgcaccatctgtgtggcctaccgcgacttcccc
agcagcccggagcctgactgggacaatgagaatgacatcctcaacgacctaacctgtatc
tgtgtggtgggcatcgaggaccccgtgcggcccgaggtcccagaagccatccgcaagtgc
cagcgagcgggcatcacagtccgcatggtcaccggtgacaatatcaacacggcccgggcc
atcgccatcaagtgtggcatcatccatcctggggaggactttctgtgcctggagggcaag
gagtttaaccggaggatccgcaacgagaagggggagattgaacaagagcgaattgataag
atctggccaaagctacgggtgctggctcgctcctcccccacggacaagcataccctcgtc
aaaggtatcatcgacagcacacacaccgagcagcggcaggtggtggccgtgacaggggat
ggcaccaacgacgggcctgcactcaagaaggctgacgtgggctttgccatgggcatcgca
ggcacggatgtggccaaggaggcctcggacatcatcctgacggatgacaacttcagcagc
atcgtcaaggcagtgatgtggggccgcaacgtctatgatagcatctccaaattcctgcag
ttccaactaacagtcaacgtagtggctgtgattgtggccttcacaggcgcctgcatcacg
caggactcccctctgaaggccgtgcagatgctctgggtaaacctcatcatggacacattc
gcctcgctggccctggccactgagccgcccaccgagaccctgcttctgaggaagccatac
ggccgtaacaagcccctcatctctcggaccatgatgaagaacatcctgggccatgccgtc
taccagctcaccctcatcttcaccctgctttttgttggcgagaagatgttccagatcgac
agtgggaggaacgcacccctgcactcgccaccctcggagcactacaccatcatcttcaac
accttcgtcatgatgcagctcttcaacgagatcaatgcccgcaagatccatggcgagcgc
aatgtctttgatggcatcttccggaacccgattttctgcaccatcgtgctgggcaccttt
gccatccagatagtgatcgtgcagtttggggggaagccgttcagctgctctccgctgcag
ctggaccagtggatgtggtgcatattcatcgggttgggagagctcgtctggggccaggtc
atcgccaccatcccgaccagcaggctcaagttcctcaaggaggcggggaggctcacgcag
aaggaggagatcccggaggaggagctgaatgaggacgtggaggagatagaccacgccgag
agggagctgcggcggggccagatcctgtggttccgaggcctgaatcggatccagacccag
attcgcgtcgtgaaggcgttccgtagctctctctatgaaggtctagaaaagcctgagtct
cgaacctccatccataatttcatggctcaccccgaattccggatcgaagattcacagccc
cacatccccctcattgacgacaccgacctggaagaagatgccgcactcaagcagaactcg
agcccgccgtcatcgctcaacaagaacaacagcgccatcgacagcgggatcaatctgacg
actgacacaagcaaatcagctacctcttcaagtccagggagccccatccacagcctggag
acgtcgctttag

KEGG   Felis catus (domestic cat): 101098392
Entry
101098392         CDS       T02385                                 
Symbol
ATP2B1
Name
(RefSeq) plasma membrane calcium-transporting ATPase 1 isoform X2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04925  Aldosterone synthesis and secretion
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04972  Pancreatic secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101098392 (ATP2B1)
   04024 cAMP signaling pathway
    101098392 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    101098392 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101098392 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098392 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    101098392 (ATP2B1)
   04972 Pancreatic secretion
    101098392 (ATP2B1)
   04978 Mineral absorption
    101098392 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101098392 (ATP2B1)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101098392 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 101098392
NCBI-ProteinID: XP_003989150
Ensembl: ENSFCAG00000007626
UniProt: M3W822
LinkDB
Position
B4:complement(113932259..114062712)
AA seq 1220 aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
SRLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKIPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcatatagtggagtaaaaaactctttgaaggaa
gctaatcatgatggagactttggaattacgctcgcggagctgcgggctctcatggagctc
aggtctacggatgcattacgaaaaatacaggaaagctatggagatgtctatggaatttgc
agcaggttgaaaacatctcccaatgaaggtttgagcggaaaccctgcagatatagagaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcag
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcattgggcctttctttttatcaacctccagaaggggataatgcactttgtggagaagtt
tctgttggagaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttatcagtagtgtgtgtggtgttagtaacagctttcaatgactggagtaaggaaaaacag
tttagaggtttgcagagtcgaattgaacaagaacagaagttcacagtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaggtgaaatac
ggtgatcttcttcctgctgatggcatactaattcaaggcaatgatcttaaaattgatgaa
agttcattgactggtgaatctgatcatgtcaagaagtctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagttactgctgtaggtgtt
aattctcagactggaattatctttaccttacttggagctggaggtgaagaggaagagaag
aaagatgaaaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aacaaagcaaaagcccaggatggtgcagccatggaaatgcagcctttgaagagtgaagaa
ggtggagatggtgatgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaatct
gtcttacaagggaagcttacaaagctggctgttcagattggcaaagcaggtttgttgatg
tctgccatcacagttatcattctagtgttatattttgtaattgatacgttctgggttcag
aagagaccatggcttgccgagtgcacgccaatttatatacaatattttgtgaagttcttc
attattggagttacagttttagtggtcgccgtgccagaaggccttccacttgcagtcacc
atctccctggcttattctgtcaagaaaatgatgaaagacaataacttagtaaggcatctg
gatgcttgtgaaaccatgggaaacgctacagctatttgttcagataaaacagggacattg
acaatgaacaggatgacagttgttcaagcttacataaatgaaaaacattataaaaagatt
cctgaaccagaagctattccaccaaatattttgtcctatcttgtaacagggatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcat
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgagattat
caggatgttagaaatgaaatcccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtgttcagaccaagggaccgtgatgatattgtaaaaacagtgattgaaccgatg
gcttcagaaggcttgagaaccatatgtcttgcgttcagagatttcccagcaggagaacca
gaacccgagtgggataatgaaaatgatattgtcaccggccttacgtgcattgctgttgtg
gggattgaagaccctgtgagacccgaggtaccagaagcaataaggaagtgtcagagggct
ggaattactgtgcggatggtcactggtgataatattaataccgctcgggctattgctacc
aaatgtggtattttacatcctggggaagattttctatgcttagaaggtaaagatttcaac
agaagaatacgaaatgaaaaaggagagattgagcaagagaggatagacaagatttggcca
aagcttcgagtacttgcaagatcttctcctactgacaaacatacactggttaaaggtata
attgacagcactgtctcagaacaacgccaggttgtagctgtaactggtgatggtacaaat
gatggcccagcactaaagaaagccgatgttggatttgcaatgggtatcgctggaactgac
gtagctaaagaagcatctgatattattctcacagatgacaactttacgagcattgttaag
gcagttatgtggggacgaaatgtctatgacagcatctccaaattccttcagttccagctc
acagttaatgtagtagcagtgattgttgctttcacgggcgcctgtattactcaagattca
ccacttaaggctgtacagatgctgtgggtgaacctcataatggatacgctcgcttccctg
gctctggcgactgaaccccccactgagtctctcttgctccggaagccttatggtagaaat
aagcctctcatctcacgcacgatgatgaagaatattttgggtcatgcattctatcaactt
gtagtagtctttacactcttatttgctggagaaaagttttttgatattgatagtggaaga
aatgctcctttgcatgctcctccttccgaacattatactattgtttttaatacctttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtattc
gaaggaatctttaataatgccatcttctgcacaattgttttaggcacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatgggaacgttactctggggccagcttatttcaaca
attccaactagccgcttaaaattcctaaaagaagctggtcatggaacacaaaaggaagaa
atacctgaggaggagctagcagaggacgtggaagagattgaccatgctgaaagggagttg
cggcgcggccagatcttgtggtttagaggtctgaacagaatccagacgcagattcgagtg
gtgaatgcatttcgtagttctttatacgaagggttagaaaaaccggaatcaagaagttcg
attcacaactttatgacacatcctgagtttaggatagaagattcagagcctcatatcccc
cttattgatgacactgatgctgaagatgatgctcctacaaaacgtaactccagtcctcca
ccctctcccaacaaaaataacaatgctgttgacagcgggattcaccttacaatagaaatg
aacaagtctgctacctcttcatccccaggaagcccactacatagtttggaaacatcactc
tga

KEGG   Felis catus (domestic cat): 101101451
Entry
101101451         CDS       T02385                                 
Symbol
ATP2B3
Name
(RefSeq) plasma membrane calcium-transporting ATPase 3 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04925  Aldosterone synthesis and secretion
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04972  Pancreatic secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101101451 (ATP2B3)
   04024 cAMP signaling pathway
    101101451 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    101101451 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101101451 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101101451 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    101101451 (ATP2B3)
   04972 Pancreatic secretion
    101101451 (ATP2B3)
   04978 Mineral absorption
    101101451 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101101451 (ATP2B3)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101101451 (ATP2B3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 101101451
NCBI-ProteinID: XP_023104701
Ensembl: ENSFCAG00000004031
LinkDB
Position
X:128505832..128568243
AA seq 1258 aa
MGDMANSSIEFHPKPQQQREAPHAGGFGCTLAELRSLMELRGAEALQKVQEAYGDVSGLC
RRLKTSPTEGLANNANDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSAGAEDEGEAEAGWIEGAAILLSVTCVVLVTAFNDWSKER
QFRGLQSRIEQEQRFSVIRDGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGETEEREKKKASVPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEVPAPSTLTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGEPRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAAQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
STGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFHGIFSNPIFCTIVLGTFAIQIVI
VQFGGKPFSCCPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAVRRRSSVLSQ
LHDVTNLSTPTHIRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDT
DVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHGTKSATSSVFSSRPGSPLHSVETSL
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgggcgacatggccaacagttccatcgagtttcaccccaagccccagcagcagcgggag
gccccccatgcgggcggctttgggtgcacactggctgagttgcgttccctcatggagctc
cgaggggctgaggcgctgcagaaggtccaggaagcctacggggacgtcagtgggctttgc
aggaggctgaagacctcgcccacagagggcctggccaacaatgccaatgacttggaaaag
cgcaggcagatctatgggcagaacttcatccctcccaagcagcccaagaccttcctgcaa
ctggtgtgggaggccctgcaggatgtgacgctaatcatcctggaggtagccgccatcgtc
tccctgggcctttcattctatgcaccgcccggagaggagagcgaagcatgcgggaacgtg
tcagctggggcagaagacgaaggggaggccgaggcaggctggatcgagggagccgccatc
ctgttgtcggtcacctgcgtggtgctggtcacggccttcaatgactggagcaaggagagg
cagttccggggcctgcagagccgcatcgaacaggaacagaggttctccgtcatccgggac
ggccagctgctgcaggttccggtggccgcactggtggtgggcgacatcgcacaggtcaag
tacggagacctgctacctgctgatggcgtgctcatccaaggcaatgacctcaagatcgat
gagagctccctgacaggcgagtcggaccacgtgcgcaaatcagctgacaaagaccccatg
ctgctctcaggtacccatgtcatggaaggttctggaagaatggtggtgactgctgttggt
gtcaactcccagacaggaatcatctttaccttgcttggagctggtggggaggaagaggag
aagaaggataagaaaggcaagcagcaggatggggcgatggagagtagccagaccaaagcc
aagaagcaggacggggcagttgccatggaaatgcagcccctgaagagtgcggagggtggg
gagactgaggaacgggagaagaagaaagccagcgtgcccaagaaggagaagtcggtcctg
cagggcaagctcaccaaactggccgtgcagatcgggaaagcagggctggtgatgtctgcc
atcaccgtcatcatcctggtcctctactttgtgattgagacctttgtcgtggacggccgg
gtgtggctggcggagtgcacgcccgtctacgtgcagtactttgtgaagttcttcatcatc
ggtgtcactgtactggttgtggccgtcccggagggcctgcctcttgccgtcaccatctcc
ttagcctactctgtcaagaaaatgatgagggacaacaacctggtccgccacctggacgcc
tgcgagaccatgggcaatgccacagccatctgctcagacaagacgggcacgctcaccacc
aaccgtatgaccgtggtccagtcctacctcggggacacccactacaaagaggttccggcc
cccagcaccctgacccccaagatcctcgacctcctggtccacgccatctccatcaacagt
gcctacaccaccaaaatactacctccagagaaggaaggcgctctcccacgccaagtgggc
aacaagacggagtgtgctctgctgggctttgtcctggacctgaagcgggacttccagcct
gtgcgggagcagattccggaagataagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacagtcatccgcatgcctgacggcggcttccgcctcttcagcaagggc
gcctcggagatcctgctgaaaaagtgcaccaacatcttaaacagcaacggggagccacgc
ggcttccgccctcgggaccgggacgacatggtgaagaagatcattgagcccatggcttgc
gatggcctccgcaccatatgtattgcctaccgggacttttccgcagctcaggagcccgac
tgggacaatgagaacgaggtcgtgggcgacctcacctgcatagccgtcgtgggcatcgag
gaccccgtgcggcccgaggttcctgaagctatccgcaaatgccagcgtgccggcatcaca
gtccgcatggtgaccggggacaacatcaacacggcccgggccatcgcggccaagtgtggc
atcatccagcccggggaggacttcttgtgcctggagggaaaggagttcaaccggcggatc
cgcaacgagaaaggcgagatagaacaggagcgtctggacaaggtgtggcccaagctgagg
gtcctcgcccgatcgtctcccaccgacaagcacactctggtcaaagggatcatcgacagc
agcaccggcgagcagcggcaggtggtagccgtgaccggggacggcaccaacgatgggcca
gccctcaaaaaggcagatgtgggctttgccatgggcattgcggggactgatgtggccaag
gaggcctcagacatcatcctgaccgatgacaacttcaccagcatcgtcaaggcggtcatg
tggggccggaatgtctacgacagcatctccaagttcctgcagttccagctgacagtcaac
gtggtggccgtgatcgtggccttcacgggggcctgcattactcaggactctcctctcaaa
gctgtgcagatgttgtgggtgaatttgatcatggacacatttgcctctctggccctggcg
acagagccacccactgagtcactgctgctacggaaaccatacggccgggacaagcccctg
atctcccgcaccatgatgaaaaacatcctgggccacgcggtctaccagctcaccatcatc
ttcacgctgctgttcgttggggagctcttcttcgacatcgacagcgggaggaacgcaccc
ctgcactctccaccgtcagagcactacaccatcatcttcaacaccttcgtcatgatgcag
cttttcaacgagatcaacgcccgcaagattcacggcgaacgaaacgtcttccacggcatc
ttcagcaaccccatcttctgtaccatcgtcctgggcacctttgcaattcagattgtcatc
gtccagttcggcggaaagcccttcagctgctgccccctgtccacggagcagtggctctgg
tgcctgttcgttggcgttggggagctggtctggggacaggtcatcgccaccatccccacc
agccagctcaagtgcctgaaggaagcagggcacgggccgggaaaggacgagatgaccgac
gaggagctggccgagggggaggaagagatcgaccatgccgagcgggagctccgcagaggc
cagatcctctggttccggggcctcaatcggattcagacgcagatggaggtagtgagtacc
ttcaagagaagcggttcatttcagggtgctgtgcgccggcggtcttcagtcctcagccag
ctccatgacgtaaccaatctttctacccctactcacatccgggtggtgaaagcgttccgt
agctcactctatgaaggcctggagaaaccggaatccaagacctccattcataacttcatg
gcgacgcccgagtttctgatcaatgactacacccacaacatcccactcatcgatgacacg
gacgtggacgagaacgaggagcgcctgcgggcccccccgcccccgtcccccaaccagaac
aacaacgccatagacagcggcatctacctgaccacgcacggcaccaagtcagctacctcg
tcagtgttttcttccagacctgggagcccgctccacagcgtggagacgtccctctag

KEGG   Felis catus (domestic cat): 101101538
Entry
101101538         CDS       T02385                                 
Symbol
ATP2B4
Name
(RefSeq) plasma membrane calcium-transporting ATPase 4 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04925  Aldosterone synthesis and secretion
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04972  Pancreatic secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101101538 (ATP2B4)
   04024 cAMP signaling pathway
    101101538 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    101101538 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101101538 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101101538 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    101101538 (ATP2B4)
   04972 Pancreatic secretion
    101101538 (ATP2B4)
   04978 Mineral absorption
    101101538 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101101538 (ATP2B4)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101101538 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 101101538
NCBI-ProteinID: XP_003999435
Ensembl: ENSFCAG00000000870
LinkDB
Position
F1:44178234..44277462
AA seq 1207 aa
MTNPTERTLPANSMVESHEREFGCTVMDLRKLMELRSTDAINQINVHYGGVTNLCSRLKT
NPVEGLSGNPADLEKRKHVFGQNFIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPPGEENEQCGLPVSSPEDEGEAEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QNRIEKEQKFSVIRNGHIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSVERDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGASEGEEEEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGTDNEEKEKKAAKLPRKEKSVLQGKLTRLA
VQIGKAGLIMSAITVLILILYFVIDNFVIHRRAWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGDTHYHQIPSPDVLLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGSKTECALL
GFVTDLKQDYHAVRNEVPEEKLYKVYTFNSVRKSMSTVIEKPSGGYRMYSKGASEIILRK
CNRILDKKGEVVPFKNKDRDEIVRTVIEPMACEGLRTICIAYRDFNDGEPPWDNESEILT
ELTCVAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGIVTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEQRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAVYQLTVIFFLVFAGEKFFDIDSGRKAPLHSPPSQHY
TIIFNTFVLMQLFNEINSRKIHGERNVFAGIFRNLIFCCVVLGTFISQILIVEFGGKPFS
CTKLTLSQWFWCLFIGIGELLWGQIISSIPTQSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPKNQNSIHNFMTHPEFAIDE
EVPRTPLLDEHEEEDLEQAPKAGTRVLLLDGEVTPYANKNNNAVDCSQVHIVASHADSPL
HSLETSV
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgacgaacccaacagaacgtaccttgccggccaactcgatggttgagagccacgagcgg
gagtttggctgcacagtaatggacctgcggaagctcatggagctacgttcgaccgacgca
atcaaccagatcaacgtccactacgggggtgtaacgaatctctgcagtagactgaaaacc
aaccccgtggaaggtctgtctgggaaccctgcggacctggagaaacgtaagcacgtgttc
ggacagaactttatcccccccaaaaagcccaagaccttcttagaactagtgtgggaagcc
ctccaagatgtcacactcatcatcctggagattgcagccatcatctccctcgtcctgtcc
ttctatcggccccccggtgaagaaaatgaacagtgtggtctacccgtaagtagcccggaa
gatgaaggagaggcagaagccggctggattgagggggcagccatcctgttctccgtgatc
atcgtggtgctggtgactgccttcaatgattggagcaaagagaagcaattccgggggctg
cagaaccgcatcgaaaaggaacagaaattctccgtgatccgaaatggtcacatcatccag
ctccccgtggctgagatcgtggtgggtgacatcgcccaaatcaaatacggtgacctactg
cccgcagatgggatcctgatccaggggaacgatctcaagattgacgagagctctctgact
ggggaatcagaccatgtcaagaagtctgtggaaagggacccaatgctgctctcagggacc
catgtcatggaaggttctggccggatggtagtgacggctgtgggtatcaactctcagact
ggaatcatctttacccttttgggagccagcgagggagaagaggaggagaagaagaaaaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaaaactcaggatggggtggcc
ctggaaatccagccactcaacagccaggaggggaccgacaacgaggagaaggagaagaag
gcggccaagctgcccagaaaggagaagtcggtgctgcagggcaagctgacgcgcttggct
gttcagatcgggaaagctggcctcatcatgtctgccatcacggttctcatcctgatcctg
tactttgtgattgacaacttcgtgatccaccgcagagcgtggctgcccgagtgcactccc
atctacatccagtactttgtcaagttcttcatcatcggcatcactgtgctggtggtggcc
gtgccagaggggctgccgctggctgtcaccatttccctggcctactccgtgaagaaaatg
atgaaagacaataacctggtgcggcacctggatgcttgtgagacaatgggcaacgccaca
gccatttgctctgataagaccggcacgttgaccatgaaccgcatgactgtggtacaggct
tatattggagacacccattaccatcagatcccgagccctgatgtcctcctgcccaaggtc
ctggaccttattgtcaatggcatttctatcaacagtgcctatacctccaagattctgcct
ccggagaaggagggaggtctgccgcggcaggtgggcagcaagaccgaatgcgctctgctg
ggctttgtcacagacctgaagcaggattaccatgcggtgcgcaatgaggtgcccgaggag
aagctctacaaggtgtacaccttcaactcggtgcgcaaatccatgagcacggtcatcgag
aagcccagcgggggctaccgcatgtacagcaagggcgcctcggagatcatcttgcgcaag
tgcaatcgaatcctggacaagaaaggggaagtggtgccgttcaagaacaaggaccgagat
gagatagtgcgcactgtcatcgagcccatggcctgtgagggcctccgaactatctgcata
gcttaccgggatttcaatgacggagagcccccgtgggacaacgagagtgagatcctcacc
gaactgacctgcgtcgcggtggtgggcattgaggaccccgtgcgcccagaggtcccagac
gctatcgccaaatgcaaacaagctggcatcactgtcagaatggtgaccggtgacaacatc
aacacagcccgggccatcgccaccaaatgtggcattgtcacacctggggatgacttcttg
tgcttagaaggcaaagagttcaaccgacttatccgcaacgagaagggcgaggtggagcaa
gagaagctggacaagatctggcctaagcttcgagtcttggcgcgatcgtcccccactgac
aagcacaccctggtgaaaggcatcatcgacagcactgttggggaacagcgacaggtggtg
gctgtcaccggcgatggcacgaatgacgggccggccctgaagaaagcagatgttggcttt
gccatgggtatcgcaggcacggatgtggcaaaggaggcatcagacatcatcctaacagac
gacaacttcaccagcattgtgaaggcagtgatgtgggggcgaaacgtctatgacagcatc
tccaagtttctgcagttccagctcactgtcaacgtggtggccgtgattgtggccttcacc
ggagcctgtatcactcaggattccccactgaaagccgtgcagatgttgtgggttaaccta
atcatggacacttttgcctccttggccctggccaccgagcctcctacggagtctctgttg
aagcgtcgcccctatggccgcaataagcctctgatctcacgtactatgatgaagaacatc
ttgggccacgcagtctatcagctcactgtcatctttttccttgtctttgccggtgagaaa
ttctttgacatcgatagcgggaggaaggcgcctctacattccccacccagccaacactac
accattattttcaacacctttgtgctgatgcagctcttcaacgaaatcaactcccgcaag
atccacggagagagaaacgtctttgcaggcatcttccgcaacctcatcttctgctgtgtg
gtcttgggcacgttcatcagccagattctcattgtggaattcgggggtaaacccttcagt
tgcacgaagctcaccctgtctcagtggttttggtgcctcttcattggcatcggagaactg
ctgtggggccagataatctcctcgatacctacgcaatccctgaagttcctgaaggaggcc
gggcatggcaccacgaaagaggagatcaccaaggacgcggaggggctggatgagatcgac
cacgcggagatggagctgcgccgaggccagatcctctggttccggggcctgaaccgcatc
cagactcagatcaaagtggtcaaagcgttccatagttccctccacgaaagcattcagaaa
cccaagaaccaaaactccatccacaacttcatgacccaccctgaattcgccatagatgag
gaggtgccacgaacaccactcctggatgagcatgaggaggaagatctcgaacaggctcct
aaggctgggactagggtgctcctgttggatggtgaggtcaccccatatgccaacaagaac
aacaatgcggtggactgcagccaagtgcacatcgttgcctcccatgcggacagccctcta
cacagcctggagacatcagtttga

DBGET integrated database retrieval system