KEGG   Felis catus (domestic cat): 101087875
Entry
101087875         CDS       T02385                                 
Symbol
OAS1
Name
(RefSeq) 2'-5'-oligoadenylate synthase 1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101087875 (OAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101087875 (OAS1)
   05171 Coronavirus disease - COVID-19
    101087875 (OAS1)
   05164 Influenza A
    101087875 (OAS1)
   05162 Measles
    101087875 (OAS1)
   05168 Herpes simplex virus 1 infection
    101087875 (OAS1)
   05169 Epstein-Barr virus infection
    101087875 (OAS1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     101087875 (OAS1)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 101087875
NCBI-ProteinID: XP_006938553
Ensembl: ENSFCAG00000000318
UniProt: M3VUI8
LinkDB
Position
D3:10679611..10692495
AA seq 401 aa
MSGWNLKDIPAGNLDKFIEDYLLPDTRFRRQVRQAIHIISTFLKERCFQDAPHPVRVSKV
VKGGSSGKGTTLRGRSDADLVVFLSNLTSFQEQLDHRGTFIWEIKRQLEACQEEETFAVQ
FEVQSLRWERPRALSFVLRSPQLQEGVEFDVLPAFDVLGQWTNTYRPDPRVYIKLIQECQ
DLDLEGEFSTCFTELQRDFLRQRPTKVKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTV
YAWERGNKQTDFSTARGFQTVLVLVLNYRELCIYWTNYYDFENPIIKQYLRRQLNKSRPV
ILDPADPTGNVAGKDRYSWQRLAEEARVWLGYPCFTNRDGSRVVSWNVQPEEDYPNDWFT
CEHRTYQYHDYGWRPEPSENLSTGLAASIPQKEDDWTCAIL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtcggggtggaacctcaaagacatccctgccgggaatctggacaagttcatcgaagac
tatctcttaccagacacacgttttcgcaggcaggtcagacaagccatccacatcatctcc
actttcctgaaggagaggtgtttccaagatgcaccacaccccgtgcgggtgtccaaagtg
gtcaagggtggctcttccggcaaaggcacgaccctcagaggccgatctgacgccgacctc
gtggtctttctgagtaacctcacaagttttcaggagcagcttgaccaccggggaacgttc
atctgggaaattaagaggcagctggaagcctgtcaagaagaggaaacgtttgcagtgcag
tttgaagtacagagtctgcgttgggagaggccccgggccctgagctttgtgctcaggtcc
ccccagctccaggagggggtggagtttgacgtcctgcctgcctttgacgtcctggggcag
tggaccaatacctacagacctgaccccagagtctacatcaagctaatccaagagtgccag
gacctggacctagagggagagttctccacctgcttcacagagctgcagcgagacttcctg
aggcagcgtccgaccaaggtgaagagcctcatccgcctagtgaagcactggtaccaactg
tgcaaggaaaagcttgggaagccactcccaccccagtacgccctggagctcctgaccgtc
tacgcctgggagcgtgggaacaagcagacagatttcagcaccgctcgggggttccagaca
gtcttggtattagtcctgaactaccgggaactttgcatctactggacaaattattacgac
tttgaaaaccctatcattaaacagtacctgaggagacagcttaataaatccaggcctgtg
attctggacccggccgaccctacaggaaacgtggccggtaaagaccggtacagctggcag
cggctggcagaagaggccagagtctggctgggttacccatgctttaccaacagggatggg
tctcgggtggtctcgtggaacgtgcagcctgaagaagactatccaaacgattggtttacc
tgtgaacacaggacatatcagtaccatgattatggatggcgtcctgaaccctctgagaac
ctcagcacgggcctggcagcatccattccccagaaggaagatgactggacgtgtgccatc
ctctga

KEGG   Felis catus (domestic cat): 101088116
Entry
101088116         CDS       T02385                                 
Symbol
OAS3
Name
(RefSeq) 2'-5'-oligoadenylate synthase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101088116 (OAS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101088116 (OAS3)
   05171 Coronavirus disease - COVID-19
    101088116 (OAS3)
   05164 Influenza A
    101088116 (OAS3)
   05162 Measles
    101088116 (OAS3)
   05168 Herpes simplex virus 1 infection
    101088116 (OAS3)
   05169 Epstein-Barr virus infection
    101088116 (OAS3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     101088116 (OAS3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Other DBs
NCBI-GeneID: 101088116
NCBI-ProteinID: XP_023097207
Ensembl: ENSFCAG00000000320
LinkDB
Position
D3:10698736..10720350
AA seq 1144 aa
MPARLGSRDAGRGGGAAGEAAPPPALPPGTEPRSGRRGQRGARADRAGGQPAVDMDVYRT
PAAALDNLVARRLQPSAEFVGAARRALGALGTFLRERGGRAAAQPWRVLKIAKGGSSGRG
TALRGGCDAELVLFLNCFKSYEDQGVRRAEILHEMRVLLESWWQKPIPGLSFEFPEQDAA
RVLRFRLASTDLENWMDVSLVPAFDALGQLNSDVKLKPQIYSRLLDSGCQGGEHAACFTE
LRRNFVNVRPAKLKSLILLVKHWFRQVCQGEVRREELPPAYALELLTIFAWEQGCGKEAF
SLAQGLRTVLGLICQYQHLCVFWTLNYGFEDPAVRWFLRYQLERPRPVILDPADPTWDVG
NGAAWHWDLLAREAESCYEHPCFLQAAGGAVQPWEGPGLPRPGCSGLDHPIQRDSAQRAP
EESSSLDAVDPSAGSRQPSRPAPGPSGTAGTTPCTLGTALDLSRISTKDLDRFIQDHLKP
NPQFQKQVSKAIDVILHCLCEKRFYRASTVSKVSRGAHFGRGTDLRGYGDAELVVFLNCF
EDYGDQRARRLEILDEMRAQLESWWQDPVPGLSLRFPEQTVPEALQFQLVSRAPGSWMDV
SLLPVFDAAGQLCAGARPEPQIYSSLLDSGCQGGKHVACFAELRRNFVNTRPPKLKNLIL
LVKHWYYQVAARNRGQQPACASLPPVYALELLTIFAWEQGCRNDCFNTAEGLKTVLGLVQ
QHQQLCVYWTVNYSFEDPAIRTYLLGQLQKPRPLLLDPADPTWNVGQGSWELLAQEAAAL
ETQACLRNRQGVSVQPWDVMPALLYQTPAGDLDKFISEFLQPSRQFLAQVNKAVNAICSF
LRENCFRSSPIKVLKVVKGGSLAKGTALRGRSDADIVVFLSCFGQFTEQGNKRAEIISEI
RAQLEACQQEMQFEVKFEIPKWENPRVLSFSLMSRTMLDQSVDFDVLPAFNALGQLSSGR
RPTSQVYVDLIHSYNNAGEYSTCFTELQRDFIVSRPTKLKSLIRLVKHWYRQCNKMPKGK
GSLPPQHGLELLTVHAWEQGGRDPQFNMAQGFRTVLELVSRYRELCVYWTVNYDNRDKTV
GDFLSQQLQKPRPIILDPADPTGNLGHNARWDLLAEEAVACMSALCCMGRDGTPIQPWPA
KAAV
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgcctgcgaggctggggagcagggacgcggggcgcggcggcggggcggctggggaggca
gccccaccccctgccctcccgccgggcacagagcccaggtcggggcgccgcgggcagcgg
ggagcgcgcgcggaccgcgcgggagggcagccggccgtggacatggacgtgtaccgcacc
cccgccgccgcgctggacaacctggtggcccgcagactgcagccgtccgccgaattcgtg
ggggctgcgcggcgcgccctgggcgccctggggaccttcctgcgggagcgcgggggccgc
gccgctgcccagccttggagggtgctgaaaatcgccaagggaggctcctctggccggggc
acagctctgaggggtggctgtgatgccgaacttgtcctcttcctcaactgcttcaagagc
tacgaggaccagggcgttcgccgtgcagagatcctccacgagatgcgggtcctgctagaa
tcctggtggcagaaacccatccccggtctgagctttgagtttcccgagcaggacgcggcc
agggtcctacggttccgactggcatccacggacctcgaaaactggatggatgtcagcctg
gtgcccgccttcgacgctctgggacagctcaattccgatgtcaaactcaagccccagatc
tactcccgcctcctcgacagcggctgccaggggggcgagcacgcggcctgcttcacggag
ctgcggaggaacttcgtgaacgttcggccggccaagctgaagagcctgatcctgctggtg
aagcactggttccgccaggtgtgccagggggaggtgaggagggaggagctgcctccagcc
tatgccctggagctgctgaccatcttcgcctgggagcagggctgtgggaaggaggccttc
agcctggcccaaggcctccgcaccgtcctgggcctgatctgtcagtatcagcacctgtgt
gttttctggaccctcaactacggcttcgaggaccctgcggtcaggtggttcttgcggtac
cagctcgagagacccaggcccgtgatcctggacccggctgaccccacgtgggacgtgggg
aacggagcagcgtggcactgggatctactggcccgagaggcagagtcttgctatgagcac
ccgtgttttctgcaggcggcggggggcgctgtgcagccctgggaggggcccggccttcca
cgtcctgggtgctcaggtttggaccaccccatccagcgagactctgcccagagggccccg
gaggagagcagcagtctcgatgccgtggacccaagtgcagggagcaggcagccctcacgc
ccagctcccggcccctcagggacagccggcaccaccccctgtactctggggacggccttg
gatctgtctcgcatcagcaccaaggacctggaccgcttcatccaggaccacctgaaaccg
aacccccagttccagaagcaggtcagcaaggccatcgatgtcatcctgcattgcctctgc
gagaagcgtttctacagggcgtccacagtcagcaaggtaagtcggggggctcattttggc
cggggcacggacctgaggggctacggtgatgccgaactcgtcgtcttcctcaactgcttc
gaggactacggggaccaaagggcccgccgcctggagatccttgatgagatgcgggcacag
ttggaatcctggtggcaagacccagtccccggcctgagcctccgttttcctgagcagacc
gtgcccgaggctttacagttccagctggtgtcccgggccccaggaagctggatggacgtg
agcctgctgcccgtctttgatgccgcggggcagctctgtgcgggcgccagacctgagccc
cagatctactccagcctcctcgacagcggctgccaggggggcaagcacgtggcctgcttc
gcagagctgaggaggaacttcgtgaacactcggccacccaagctgaagaacctgatcctg
ctcgtgaagcactggtattaccaggtcgcagctcggaacagaggacagcagccagcctgt
gcctccctgcccccagtctatgccctggagctcctgaccatcttcgcctgggagcagggc
tgcaggaacgattgtttcaacacggctgaaggcctcaagacggtcctagggctcgtccag
cagcaccagcagctttgtgtctactggacggtcaactacagctttgaggacccagctatc
agaacataccttcttggccagcttcagaaacccaggcccctgctcctggatcctgctgac
cccacctggaatgtgggccagggcagctgggagctgttggcccaagaagcagcagctctg
gagacacaggcctgccttaggaatagacagggggtgtctgtgcagccctgggatgtgatg
cctgctctcctttaccaaacaccagctggggaccttgacaagttcatcagtgaatttctc
cagcccagccgccagttcttggctcaggtgaacaaggccgtcaacgccatctgctcattc
ctgagggaaaactgcttccggagttctcccatcaaagtgctcaaggtggtcaagggtggc
tctttagccaaaggcacagctctgcgaggccgctcagatgctgatatagtggtgttcctc
agctgcttcggccagttcaccgaacaagggaacaagcgggctgagatcatctcagagatc
cgagcccagctggaggcatgtcagcaggagatgcagttcgaggtgaagttcgagatcccc
aagtgggagaatccccgcgttttgagcttctctctgatgtcccggacgatgctggatcag
agcgtggactttgacgtgctgccagcctttaacgccttaggccagctgagctccggcagg
aggcccacgtctcaagtctacgtcgacctcatccacagctacaacaacgcgggcgagtac
tccacctgtttcacggagctgcagagggacttcatcgtctctcgccccaccaagctgaag
agtctgatccgattggtcaagcactggtaccggcagtgcaacaagatgcccaaggggaaa
ggctccctgcccccccagcacgggctagagctcctgacggtgcatgcctgggagcagggc
ggccgggacccccagttcaacatggcgcaaggcttccgcaccgtcctggagctggtcagc
cggtaccgtgagctctgtgtctactggaccgtcaactacgacaaccgggacaagactgtc
ggggacttcctgagccagcagcttcagaagcccaggcccatcatcctggatccagctgac
ccgacgggcaacctgggccacaatgcccgctgggacctgctggccgaggaagctgtggcc
tgcatgtctgccctgtgctgcatgggcagggacggcacccccatccagccatggccagcg
aaggctgccgtgtga

KEGG   Felis catus (domestic cat): 102902426
Entry
102902426         CDS       T02385                                 
Symbol
OAS2
Name
(RefSeq) 2'-5'-oligoadenylate synthase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102902426 (OAS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102902426 (OAS2)
   05171 Coronavirus disease - COVID-19
    102902426 (OAS2)
   05164 Influenza A
    102902426 (OAS2)
   05162 Measles
    102902426 (OAS2)
   05168 Herpes simplex virus 1 infection
    102902426 (OAS2)
   05169 Epstein-Barr virus infection
    102902426 (OAS2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     102902426 (OAS2)
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2 DUF943
Other DBs
NCBI-GeneID: 102902426
NCBI-ProteinID: XP_006938556
Ensembl: ENSFCAG00000000322
UniProt: M3VUJ0
LinkDB
Position
D3:10722893..10742441
AA seq 708 aa
MGIWGSHLYSVQPEKLEELIQISLRPYGGCQKQIEDTVNAICAFLEETRQLPQVICVAKG
GSYGRRTVLRGNSDGTIVIFVSDLERFQDQKKSQDEILSKIWQGLKTCQLTMKLEAGMEI
WKLHGRLIFQLSTKWQSITFEVLPAYNALGLSEKPSPQIYRELKRALDMTKALPGEFSVC
FTELQQKFFHNRPRKLTDLILLVKHWYQQCQAKLKGSPPLPMYALELLTVYAWEQGCGAE
NFDIVEGLRTVLGLIKQQEQLCVYWMVNYNFENETVRNILLSQLRSSRPVIVDPADPTNN
VGKDKACWQMLQQEAQIWLSCLSPNEPPGPSWDVLPAPLYATPGHLLDKFIKDFLQPDRN
FLGQIATAVDIICRFLQKNCFPHSATRVQKTVKGGSTGKGTALKTGSDADLVVFPDSLKS
YTSQKSERCSIIKEVRKQLEACQQEKKLEVKFEISKWKAPRVLSFSLKSRVLNERVDFDV
LPAFNALGQLNFGSTPSPKVYAELIDLYKSSDAEGGEFSTCFTELQCNFVAFRPIKLKDL
IRLVKHWYKQCERKLKQKGSLPPKYALELLTIYAWEQGSGAENFDTAEGFRTVLELVTKY
QQLCVFWTVNYNFEDETVRNFLLTQIQRTRPVILDPADPTGDVGGGDRWCWHLLAKEATE
WLSSFCFKDGTGYPVRSWKVPTVQTPGSCGCSHSEVIGSWNPNARRNF
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgggcatctgggggtcgcatctgtactccgtgcagccggagaagctggaggagttgatt
cagatctccctgaggccctatggaggatgtcagaagcagatcgaggacacggtgaacgcc
atctgtgccttcctggaggaaaccaggcagctcccccaagtgatatgtgtggctaaaggt
ggctcctatggcaggagaacggtgttgaggggcaactccgatggtacgattgtcatcttt
gtgagcgaccttgagcggtttcaggatcagaaaaaaagccaggatgaaatcctcagcaag
atctggcaggggctgaaaacctgtcagctcacaatgaagctggaggccggaatggagatc
tggaagctccatggtaggctcatcttccagctgtccacaaaatggcagagcatcactttt
gaggtgctccctgcttacaacgctctgggcttaagtgagaagcccagcccccagatctac
cgagagctcaaaagagccctggatatgaccaaagccctccccggcgaattctccgtctgc
ttcacagaactccagcagaagttttttcacaaccgtcccagaaaactgacagatttgatc
ctcttggtaaagcactggtaccaacagtgccaggcaaagctgaaagggtcacccccgctg
cccatgtatgctctggagttgctgacagtctacgcctgggaacaggggtgcggagcagaa
aactttgacatcgtggaaggcctcaggaccgtcctggggctaatcaaacagcaggagcag
ctgtgtgtctactggatggtcaactacaactttgagaatgagacggtccggaacatcctg
ctgagccagctccggtcatcaaggccggtcatcgtggacccagccgacccgaccaacaac
gtgggcaaagataaggcgtgctggcaaatgctgcagcaggaagctcagatctggttgtca
tgtctcagcccgaacgagccacctgggccgtcgtgggatgttctgccagcgccactgtac
gcgacaccgggccaccttctggataagttcatcaaggactttctccagccggacagaaat
ttcctgggccagattgcgacagctgttgacatcatctgtagattccttcaaaaaaattgc
tttccacattcagctacaagagttcagaaaactgtcaagggagggtcgaccggcaaaggc
acggctctgaagacgggctccgatgccgacctcgtggtgttcccagactcgcttaaaagc
tacacctcccaaaaaagtgagaggtgcagtatcatcaaggaagtccgtaaacagctagaa
gcctgtcagcaggagaaaaagctcgaagtgaagtttgagatttcaaaatggaaggctccc
agggtgctgagcttctctctaaaatccagagtgctcaacgaaagggttgactttgatgtg
ctgcctgcatttaatgcgctaggtcagctgaacttcggctctacacccagccccaaggtc
tacgcggagctcattgacctgtataaatcctcagacgccgaggggggagaattttccacc
tgtttcacggagctgcagtgcaacttcgtggccttccgacccatcaagctgaaggattta
attcgtctggtgaagcactggtacaaacagtgtgaaaggaaactgaagcaaaaggggtct
ctgcccccgaagtacgccttggagctgctcaccatctacgcctgggagcaggggagcggg
gcagagaatttcgacaccgccgagggattccggacggtcctggagttggtcacaaaatac
cagcagctctgtgtcttctggacggtcaattacaactttgaggatgagaccgtgaggaac
ttcctactgacccagatccagagaaccaggcccgtgatcttggacccggctgaccccact
ggtgacgtaggtggaggggaccgatggtgctggcatcttctggcaaaagaagctaccgaa
tggctgtcctctttctgcttcaaagatgggactggatatcccgtacgatcgtggaaagtg
ccaacagtgcagactccaggaagttgtggatgttctcattcagaagtcataggatcctgg
aaccctaacgctagaagaaacttctag

DBGET integrated database retrieval system