KEGG   Felis catus (domestic cat): 101088062
Entry
101088062         CDS       T02385                                 
Symbol
BTK
Name
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase BTK
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05169  Epstein-Barr virus infection
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101088062 (BTK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101088062 (BTK)
   04662 B cell receptor signaling pathway
    101088062 (BTK)
   04664 Fc epsilon RI signaling pathway
    101088062 (BTK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101088062 (BTK)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101088062 (BTK)
  09163 Immune disease
   05340 Primary immunodeficiency
    101088062 (BTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101088062 (BTK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101088062 (BTK)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  TEC family
   101088062 (BTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 ABC1 Pkinase_fungal Kdo APH Haspin_kinase SH3_4
Other DBs
NCBI-GeneID: 101088062
NCBI-ProteinID: XP_023104904
Ensembl: ENSFCAG00000015395
LinkDB
Position
X:complement(83589631..83613491)
AA seq 664 aa
MATVILESIFLKRSQQKKKTSPLNFKKRLFLLTVNKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLAQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQVYREIDLEKPLPPEPTAAPASTSELKKVVALYDYMPMNANDLQL
RKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLL
KQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDSQGVIRHYVVCSTPQSQYYLAEKHLFSTI
PELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGV
VKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITE
YMANGCLLNYLREMRHRLQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVV
KVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGK
MPYERFTNSETAEHIAQGLRLYRPHLASERVYSIMYSCWHEKAEERPTFKILLSNILDVM
DEES
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggctacagtgatactggagagcatctttctcaagcgatcccaacagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctctttctcttgactgtgaataaactttcctattat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagatgttgagaag
atcacctgcgttgaaacagtggttcctgaaaaaaatcctccccctgaaagacagattccg
agaaggggtgaagaatccagtgaaatggagcagatttctatcattgaaaggttcccttat
cccttccaggttgtatatgatgaagggcctctttatgtcttctccccaactgaagaactg
aggaagcgttggattcatcagctcaaaaatgtaatccggtacaacagtgatctggcacag
aaataccatccttgcttctggatcgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggagaataggaatggaagtttaaaacctgggagttct
caccgaaagacgaaaaagccccttcctcccacacctgaggaggaccaggtatacagggaa
attgatcttgaaaagcctctgccccctgagccaacagcagcacctgcctctacaagtgag
ctgaaaaaggttgtagccctttatgattatatgccaatgaatgcaaatgatctacagcta
cgaaagggtgatgagtattttatcctggaggagagcaacttaccctggtggagagcgcgg
gataaaaatgggcaagaaggctacatccctagtaactatgtcaccgaagcagaagactcc
atagaaatgtatgagtggtattctaaacacatgactcggagtcaagctgagcaactgcta
aagcaagaggggaaagaaggaggcttcattgtcagagactccagcaaagcaggaaaatat
actgtgtctgtgtttgctaaatctacaggggactctcaaggggtgatacgccattatgtt
gtgtgttccacacctcagagccagtattacctggctgagaagcaccttttcagcaccatc
cctgaactcattaactaccatcagcataactctgcaggactcatatctaggctcaaatat
ccagtgtctcaacaaaacaagaatgcaccttccactgcaggcctgggctacggatcatgg
gaaatcgatccaaaggacctgaccttcttaaaggagctggggactggacaatttggggta
gtgaaatatgggaaatggagaggccagtatgatgtggccatcaagatgatcaaagaaggc
tccatgtccgaggatgagttcattgaagaagccaaagtcatgatgaatctttcccatgag
aagctggtacagttgtatggcgtctgtaccaagcagcgccccatcttcatcatcactgag
tacatggccaatggctgcctcctgaactacctgagggaaatgcgccaccgcctccagact
cagcagctgctggagatgtgcaaggatgtctgtgaagccatggaatacctggagtcaaag
caatttcttcaccgagacctggcagcccgaaactgtttggtaaatgatcaaggagttgtt
aaagtatctgacttcggcctgtccaggtatgtcctggatgatgaatacacaagctcagta
ggctccaaatttccagtccggtggtctccaccagaagtccttatgtatagcaagttcagc
agcaaatctgacatttgggcttttggggttttgatgtgggaaatttactctctggggaag
atgccatatgaaagatttactaacagtgaaacagctgaacacattgcccaaggtctacgt
ctctataggcctcatctagcttcagagagggtatatagcatcatgtacagctgctggcat
gagaaagcagaggaacgtcctactttcaaaattcttctgagcaacatcctagatgtcatg
gatgaagaatcctga

KEGG   Felis catus (domestic cat): 111559190
Entry
111559190         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase BTK-like
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05169  Epstein-Barr virus infection
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111559190
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111559190
   04662 B cell receptor signaling pathway
    111559190
   04664 Fc epsilon RI signaling pathway
    111559190
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111559190
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111559190
  09163 Immune disease
   05340 Primary immunodeficiency
    111559190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    111559190
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111559190
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  TEC family
   111559190
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 Pkinase_fungal APH ABC1 Haspin_kinase Kdo SH3_4
Other DBs
NCBI-GeneID: 111559190
NCBI-ProteinID: XP_023105545
LinkDB
Position
X
AA seq 665 aa
MATVILESIFLKRSQQKKKTSPLNFKKRLFLLTVNKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISSIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLAQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HXKTKKPLPPTPEEDRYTGKLILKKPLPPEPTAAPASTSELKKVVALYDYMPMNANDLQL
RKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLL
KQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDSQGVIRHYVVCSTPQSQYYLAEKHLFSTI
PELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGV
VKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKNLSHEKLVQLYGVCTKQRPIFIITEYLS
NGCLLNYLREMRHRLQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVS
DFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPY
ERFTNSETAEHIAQGLRLYRPHLASERVYSIMYSCWHEHFDRIATPGYKAGGLPADVGSG
RWVAS
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggctacagtgatactggagagcatctttctcaagcgatcccaacagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctctttctcttgactgtgaataaactttcctattat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagatgttgagaag
atcacctgcgttgaaacagtggttcctgaaaaaaatcctccccctgaaagacagattccg
agaaggggtgaagaatccagtgaaatggagcagatttctagcattgaaaggttcccttat
cccttccaggttgtatatgatgaagggcctctttatgtcttctccccaactgaagaactg
aggaagcgttggattcatcagctcaaaaatgtaatccggtacaacagtgatctggcacag
aaataccatccttgcttctggatcgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggagaataggaatggaagtttaaaacctgggagttct
cacncgaagacgaaaaagccccttcctcccacacctgaggaggacaggtatacagggaaa
ttgatcttgaaaaagcctctgccccctgagccaacagcagcacctgcctctacaagtgag
ctgaaaaaggttgtagccctttatgattatatgccaatgaatgcaaatgatctacagcta
cgaaagggtgatgagtattttatcctggaggagagcaacttaccctggtggagagcgcgg
gataaaaatgggcaagaaggctacatccctagtaactatgtcaccgaagcagaagactcc
atagaaatgtatgagtggtattctaaacacatgactcggagtcaagctgagcaactgcta
aagcaagaggggaaagaaggaggcttcattgtcagagactccagcaaagcaggaaaatat
actgtgtctgtgtttgctaaatctacaggggactctcaaggggtgatacgccattatgtt
gtgtgttccacacctcagagccagtattacctggctgagaagcaccttttcagcaccatc
cctgaactcattaactaccatcagcataactctgcaggactcatatctaggctcaaatat
ccagtgtctcaacaaaacaagaatgcaccttccactgcaggcctgggctacggatcatgg
gaaatcgatccaaaggacctgaccttcttaaaggagctggggactggacaatttggggta
gtgaaatatgggaaatggagaggccagtatgatgtggccatcaagatgatcaaagaaggc
tccatgtccgaggatgagttcattgaagaagccaagaatctttcccatgagaagctggta
cagttgtatggcgtctgtaccaagcagcgccccatcttcatcatcactgagtacttgtcc
aatggctgcctcctgaactacctgagggaaatgcgccaccgcctccagactcagcagctg
ctggagatgtgcaaggatgtctgtgaagccatggaatacctggagtcaaagcaatttctt
caccgagacctggcagcccgaaactgtttggtaaatgatcaaggagttgttaaagtatct
gacttcggcctgtccaggtatgtcctggatgatgaatacacaagctcagtaggctccaaa
tttccagtccggtggtctccaccagaagtccttatgtatagcaagttcagcagcaaatct
gacatttgggcttttggggttttgatgtgggaaatttactctctggggaagatgccatat
gaaagatttactaacagtgaaacagctgaacacattgcccaaggtctacgtctctatagg
cctcatctagcttcagagagggtatatagcatcatgtacagctgctggcatgagcatttc
gaccgcatcgcaacacccggctacaaggccggaggcctcccagctgacgtagggagcggc
cgctgggtcgcgagctag

DBGET integrated database retrieval system