KEGG   Felis catus (domestic cat): 101088165
Entry
101088165         CDS       T02385                                 
Symbol
HDAC2
Name
(RefSeq) histone deacetylase 2 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04213  Longevity regulating pathway - multiple species
fca04330  Notch signaling pathway
fca04613  Neutrophil extracellular trap formation
fca04919  Thyroid hormone signaling pathway
fca05016  Huntington disease
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101088165 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101088165 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101088165 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101088165 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101088165 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088165 (HDAC2)
   05202 Transcriptional misregulation in cancer
    101088165 (HDAC2)
   05206 MicroRNAs in cancer
    101088165 (HDAC2)
   05203 Viral carcinogenesis
    101088165 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101088165 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101088165 (HDAC2)
   05165 Human papillomavirus infection
    101088165 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101088165 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    101088165 (HDAC2)
   05034 Alcoholism
    101088165 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101088165 (HDAC2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101088165 (HDAC2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101088165 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     101088165 (HDAC2)
    BRAF-HDAC complex
     101088165 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101088165 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    101088165 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101088165
NCBI-ProteinID: XP_003986525
Ensembl: ENSFCAG00000018836
LinkDB
Position
B2:complement(105487491..105517396)
AA seq 458 aa
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGD
RLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAV
HEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
KKETEDKKADVKEEDKSKDSSGEKTDTKGAKSEQLSNP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaacctcatagaatccgcatgacccacaacttgctgctaaattatggcttatataga
aaaatggaaatatataggccccataaagccactgctgaggaaatgacaaaataccacagt
gatgagtacatcaaatttctacgttcaataagaccagataatatgtctgagtatagtaag
cagatgcagagatttaatgttggagaggactgtccagtgtttgatggactctttgagttt
tgtcagctctcaactggtggctcagttgctggagctgtgaagttaaaccgacaacaaact
gatatggctgttaactgggctggaggattacatcatgctaagaaatcagaagcatcagga
ttctgttatgttaatgatattgtccttgccatccttgagttactaaagtatcatcaaaga
gtcttatatattgatattgatatccatcatggtgatggtgtcgaagaagctttttatacc
acagatcgtgtaatgactgtatcattccataagtatggggaatactttcccggaacagga
gatttgcgggatattggtgctggaaaaggcaaatactatgctgtcaattttccaatgaga
gatggtatagatgatgagtcctatgggcagatttttaagcctattatctcaaaagtgatg
gaaatgtatcaacctagtgctgtggtgctacagtgtggtgctgactcactatctggtgat
aggcttggttgcttcaatttgacagtcaaaggtcatgctaaatgtgtagaagttgtaaaa
actttcaatttaccattactgatgcttgggggaggtggatacacaattcgtaatgttgct
cgatgttggacgtacgagactgcagttgcccttgattgtgagattcccaatgaattgcca
tataatgattactttgagtattttggcccggacttcaaactgcatattagtccttcaaac
atgacaaaccagaatactcccgaatatatggaaaagataaaacagcgcttatttgaaaat
ttacgcatgttacctcatgcacctggcgtccagatgcaagctattccagaagatgctgtt
catgaagacagcggagatgaagatggagaagatccagacaagagaatttctattcgagca
tctgacaaacggatagcttgtgatgaagaattctcagactctgaggatgaaggagaagga
ggtcgtagaaatgtggctgatcataagaaaggagccaagaaagctagaattgaagaagac
aagaaggaaacagaggacaaaaaagcagatgttaaggaagaagataaatccaaggacagt
agtggtgaaaaaacagataccaaaggagccaaatcagaacagctcagcaacccttga

KEGG   Felis catus (domestic cat): 101099228
Entry
101099228         CDS       T02385                                 
Symbol
HDAC1
Name
(RefSeq) histone deacetylase 1 isoform X3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04213  Longevity regulating pathway - multiple species
fca04330  Notch signaling pathway
fca04613  Neutrophil extracellular trap formation
fca04919  Thyroid hormone signaling pathway
fca05016  Huntington disease
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101099228 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101099228 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101099228 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101099228 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101099228 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099228 (HDAC1)
   05202 Transcriptional misregulation in cancer
    101099228 (HDAC1)
   05206 MicroRNAs in cancer
    101099228 (HDAC1)
   05203 Viral carcinogenesis
    101099228 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101099228 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101099228 (HDAC1)
   05165 Human papillomavirus infection
    101099228 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101099228 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101099228 (HDAC1)
   05034 Alcoholism
    101099228 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101099228 (HDAC1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101099228 (HDAC1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101099228 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     101099228 (HDAC1)
    BRAF-HDAC complex
     101099228 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101099228 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    101099228 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101099228
NCBI-ProteinID: XP_003989864
Ensembl: ENSFCAG00000012483
UniProt: A0A2I2UTS8
LinkDB
Position
C1:24557578..24589219
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctatcgaaaaatggaaatatatcgccctcacaaggccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaaacagatgcagagattcaacgttggtgaggactgt
ccggtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcat
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccgggaactggggacctacgggatattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacccagtgcagttgtcttacag
tgtggctctgactccctatctggggatcggttaggttgcttcaacctgaccatcaaaggg
cacgccaagtgtgtagagtttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggcggttataccatccgtaacgtggcccgctgctggacgtatgaaacagccgtggctctg
gacacggagatcccaaatgagcttccatacaacgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacaccaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgcgaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgttcctctgacaaacgaatcgcctgtgaggaagagttc
tcggactctgatgaagagggagaaggcggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system