KEGG   Felis catus (domestic cat): 101088294
Entry
101088294         CDS       T02385                                 
Symbol
RFXAP
Name
(RefSeq) regulatory factor X-associated protein
  KO
K08063  regulatory factor X-associated protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101088294 (RFXAP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088294 (RFXAP)
  09163 Immune disease
   05340 Primary immunodeficiency
    101088294 (RFXAP)
SSDB
Motif
Pfam: RFXA_RFXANK_bdg
Other DBs
NCBI-GeneID: 101088294
NCBI-ProteinID: XP_011285942
LinkDB
Position
A1:15572245..15653022
AA seq 512 aa
MEKLIITVYAINATKTLWVSPVVNHDVMVLPRVSSPLFRGKPQPGKVTAVLKLLFLKAYL
PLNLHGWQGTADHQGDAAVLQDGLFQSRVADRTSFKDAPYLLAWCDSQVNRQPRGKFKEE
IFVTAEEGIPLTEKAPEEAEGMRLSPDTVGFSKKARSYRARTERLQLHTEPPQQRRRQRS
ETQRSASSQRRSRTCAPEPFPLRGLWLAKCRWASHLLKGWGRGPLQGVSSTEVQGVVEGA
GPGAAGGALRPGAPATALGQALAPASVPAPASQFTLLVMHPCGGQDESAAEGVLRQPPAL
GDGGAGTGKSIRYLCEVAGAGEEEAGEDEADLLDTSDAPGGGESTASLEDLEDEETHSGG
EGGSGGARRRGGGGGSMSKTCTFEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSD
QALNCSGAAQPGSAGNVRLEESTDNILSIVKQRTGTFGDRPARPTLLEQVLNQKRLSLLR
SPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggagaaactcataatcacagtctatgccatcaatgccacgaagacactgtgggtgtcc
cctgtggtgaaccatgatgtcatggtgcttcccagagtatcatcccccctcttccgggga
aaaccccagccaggaaaggtcactgcagttttaaagttgctgttccttaaagcctatcta
cctcttaacctccatggctggcaagggactgctgaccaccaaggggatgctgcagtcctc
caggacggcctcttccagtcgagggttgcagacagaactagcttcaaagatgccccgtat
ctactcgcgtggtgtgacagtcaagtaaatcggcagcccagaggcaagtttaaagaggag
atatttgtaactgcagaggaaggcatacccttgacagagaaagctcctgaagaagctgaa
gggatgagattgagcccagacacagtaggtttcagcaaaaaagcgcggtcttaccgagcg
cgcacagagagacttcaactgcacacagaacctccacagcagcggcggcgccagcgcagc
gaaacgcaacgcagcgcttccagccagcgccgcagccgcacttgcgcaccggagcctttt
cccctccgtggtctttggcttgcgaagtgccgctgggcttcgcatttgttgaaaggctgg
ggtcgtggacccctgcaaggtgtcagcagcacggaggtgcagggcgtcgtcgagggtgcg
gggccgggcgccgccggtggcgcgctccgccccggggcccccgccactgctctgggccag
gccctggctccagcctccgtcccggccccggcctcgcagttcaccctgctggtgatgcac
ccctgcggagggcaggacgagtccgcggcggagggcgtcctcaggcagcctccggccctg
ggggacggcggcgccgggacgggcaagtccattaggtacctgtgcgaagtggcgggggct
ggcgaggaggaggcaggggaggacgaagccgacctgctggacacttcagacgccccgggg
ggaggcgagagcacggctagtttggaggatctggaggacgaggagacacactcggggggc
gagggcggcagcgggggagcccggagacggggtggcggcgggggcagcatgagcaagacc
tgcaccttcgagggctgcagcgagaccacgagccaggtggccaagcagcgcaagccttgg
atgtgcaaaaaacaccgcaacaagatgtacaaggacaagtacaaaaagaagaaaagtgat
caggccctgaactgcagtggggccgcccagcctggcagcgcgggaaacgtcagactggag
gaaagtacagataacatactctccattgttaaacaaagaacaggaacctttggggatcgt
cctgcaagacccactcttttagaacaagtgttaaatcagaaaagactgtcattactaaga
agtccagaagtggtgcaatttttacagaaacagcaacaactattaaatcagcaagttttg
gagcaaagacagcagcagtttccaggaacatcagtgtga

KEGG   Felis catus (domestic cat): 101098525
Entry
101098525         CDS       T02385                                 
Symbol
RFXANK
Name
(RefSeq) DNA-binding protein RFXANK isoform X1
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101098525 (RFXANK)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098525 (RFXANK)
  09163 Immune disease
   05340 Primary immunodeficiency
    101098525 (RFXANK)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank Ank_4
Other DBs
NCBI-GeneID: 101098525
NCBI-ProteinID: XP_006928719
Ensembl: ENSFCAG00000009775
UniProt: M3WC37
LinkDB
Position
A2:14215528..14222209
AA seq 260 aa
MEPTQPAEDLSLTQQLPIPEFGDPEDPSDEAPDGSDTVVLSLFPCTLEPGNPEPDAGASS
PQGGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLRKGDNLINKP
DEHGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASMGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
NT seq 783 nt   +upstreamnt  +downstreamnt
atggagcccacccagccggcagaggacctcagtctgacccaacagctccccatcccagaa
tttggggaccctgaggaccccagcgatgaggcccccgatggctcagacactgtggtgctc
agtctcttcccctgcactctggagcctgggaatcctgaaccggatgctggtgcctcctca
ccgcagggaggcagctccctgaagcactccacaaccctcaccaaccggcagcgggggaac
gaggtttcggccctgccagccaccctcgactccctgtccatccaccagctcgcggcccag
ggggagctgagccagctgaaggaacatctgaggaaaggcgacaacctcatcaacaagccg
gacgagcatggcttcacccccctcatctgggcctccgcctttggagaaatcgagactgtc
cgcttcttgctcgagtggggtgctgacccccacatcctggccaaggaacgggaaagcgcc
ctgtccctggccagcatgggcggctacacagacattgtagggctgctacttgagcgtgac
gtggacatcaacatctacgactggaatggagggacgccactgctgtacgccgtgcgtggg
aaccacgtgaagtgcgtagaagccttgttggcccgaggagccgatctcaccactgaggct
gactccggctataccccaatggaccttgccgtggccctgggatatcggaaagtgcaacag
gtgatcgagaaccacatcctcaaactcttccagagcaacctggtgcccgcagatcctgag
tga

KEGG   Felis catus (domestic cat): 101099317
Entry
101099317         CDS       T02385                                 
Symbol
RFX5
Name
(RefSeq) LOW QUALITY PROTEIN: DNA-binding protein RFX5
  KO
K08061  regulatory factor X 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101099317 (RFX5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101099317 (RFX5)
  09163 Immune disease
   05340 Primary immunodeficiency
    101099317 (RFX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101099317 (RFX5)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Other basic domains
   RF-X
    101099317 (RFX5)
SSDB
Motif
Pfam: RFX5_DNA_bdg RFX5_N RFX_DNA_binding Pox_D5
Other DBs
NCBI-GeneID: 101099317
NCBI-ProteinID: XP_019693392
Ensembl: ENSFCAG00000005568
LinkDB
Position
C1:complement(106416290..106422529)
AA seq 622 aa
MAEDEPDAKSPKTGGRPPSGSAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDND
KLYLYLQLPSGPSTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKY
CESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDL
KGSESPEMGPEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARS
APAHVLKAVGLADDDEHAPRERSSKSKNGVESLEGGAHKKPERPAQPPKEPEPRAGAGPP
ARGERKKSVVESPAPAASNPQVNALVARLPLLLPRAPRSLIPPLQVSPPILAPKLSSGPL
KVALPSRAGGPQAAVPIINMILPAVPALPGPGPGPGPGPGPGPGLGLGKPPGVLAQPRGT
ENREVGIGGDPGPHDKGVKRSAEVPVSEAIGQDPPAKAAKQDIDDTGSDAKRKRGRPRKK
SGGSRERNSTPDKSAAAVDSAQPCRLPRETWASAGESNSARGSGRPGPVGGAEKGMVLAR
DQEDGVVSRGGKGPSSRHAKEAEDKIPLVTSKVSVIKGSRSQKEALPKEEVDTAAQGNKD
LKGHVLQNSLSHEGKDPQATPP
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcagaagatgaacccgacgctaagagccccaagactgggggacggcccccctcaggt
agtgctgaggcgggagaacccaccacccttcttcagaggctccgaggtaccatttccaag
gccgtgcagaacaaagtcgaggggatcctgcaagatgtacagaaattctcagacaacgac
aagctgtatctctaccttcagctcccctcaggacccagtactggagacaaaagctcagag
ccaagtacacttagcaatgaggagtacatgtatgcctatcgatggatccgcaaccatcta
gaagagcatactgacacctgtttgccaaagcaaagtgtttatgatgcctatcggaagtac
tgtgagagtcttgcctgttgccgcccactcagcaccgccaactttggcaaaatcatcaga
gagatcttccctgacatcaaggcccgaaggcttggtggccgaggccagtccaaatattgc
tacagtggcatacgaaggaagaccttggtgtctatgccacccttacctggacttgacctg
aagggctctgagagtccagaaatgggcccagaagtaaccccagcaccccgggacgaactg
gttgaggcagcctgcgctctgacctgtgactgggcagaacgaatcctgaaacgatccttc
agttccatcgttgaagtcgcccgcttcctcctgcagcagcacctcatctctgcccggtct
gcccctgcccacgtactcaaggcagtggggctcgctgacgacgatgaacatgcccctcgg
gagcggtcctctaaatccaagaatggtgtcgagagcctagagggtggagcccataagaaa
ccagagagaccagcccagccacctaaggagccagaaccccgggctggggctggccctcct
gcacgtggagagcggaagaagagtgtagtggagagcccagccccagcagccagtaaccca
caggttaatgccctggtggcccggctgcctctgctccttccccgggcccctcgctcactt
attccaccactccaagtctctccccccatcctggcccccaagctttcttcaggccctctg
aaagtggctctgcccagtagggctgggggaccccaggcagctgtgcccatcattaacatg
atcttaccagctgttcctgctttgcctggacccgggcctgggcctgggcctgggcctggg
cctgggcctggcctgggcctgggcaagccccctggggtgctcgctcagccacgaggcaca
gagaacagggaggtaggcataggtggtgacccaggaccccatgacaaaggtgtcaagaga
tcagcagaagtacctgtgagtgaggccattgggcaggatccaccagctaaagcagcaaag
caggatatagacgatacaggaagtgatgccaaaagaaaacgggggcgccctcgaaaaaaa
tcaggtggaagtagggaaaggaactctacccctgacaagtcagcagctgccgtggactct
gcccagccctgccggttaccacgggagacatgggcctctgcaggggagagcaactctgcc
agagggtcagggagaccagggccagtgggaggggctgagaaggggatggtgcttgcccgg
gatcaggaagatggtgttgtttccagaggaggaaagggccccagttcccggcatgccaaa
gaagcagaagataaaattcctctggtcacctcaaaagtgagtgtcatcaagggcagtaga
agccaaaaggaggctcttccaaaggaagaggtagacactgcagcacagggtaataaagac
ttaaaagggcacgtgcttcagaattccttatcccatgaagggaaagacccccaagcaaca
cccccttga

DBGET integrated database retrieval system