KEGG   Felis catus (domestic cat): 101088326
Entry
101088326         CDS       T02385                                 
Symbol
GAB1
Name
(RefSeq) GRB2-associated-binding protein 1 isoform X4
  KO
K09593  GRB2-associated-binding protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04722  Neurotrophin signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05205  Proteoglycans in cancer
fca05211  Renal cell carcinoma
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101088326 (GAB1)
   04014 Ras signaling pathway
    101088326 (GAB1)
   04072 Phospholipase D signaling pathway
    101088326 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101088326 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101088326 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101088326 (GAB1)
   05226 Gastric cancer
    101088326 (GAB1)
   05211 Renal cell carcinoma
    101088326 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101088326 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101088326 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101088326 (GAB1)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   101088326 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_8 PH_3 PH_9 PH_13 PH_2
Other DBs
NCBI-GeneID: 101088326
NCBI-ProteinID: XP_003985029
Ensembl: ENSFCAG00000027102
UniProt: M3X119
LinkDB
Position
B1:complement(85309563..85431740)
AA seq 694 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDLVKPPGNSAQAPADLPLAVNTAPPSTQVDSSSAAPPPPYQLINLPPHLETVGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGVNGFFQQQM
MYDSPPSRAASVSVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SITRTASDTDSSYCIPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSL
EGFHNHFKIKNILTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKAKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPLSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
SNLFGSNSLDGRSSPMVKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPAKNVK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtctgctcgggatggctccgcaagtcccccccggagaagaag
ttgaaacgttatgcatggaagaggagatggtttgtgttacgcagtggtcgcttaactgga
gatccagatgtcctggagtattacaaaaatgatcatgccaagaagcctatccgtattatt
gatttaaatttatgtcagcaagttgatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacaccattgaccgaattttctacttggtagcagacagt
gaggaagagatgaataagtgggttcgttgcatttgtgacatctgtgggtttaatcctacg
gaggaagatcttgtgaagccccctggcaactctgcccaggcgccagccgatttacctttg
gcggtcaacacggcaccgccgtccacccaggtagattcatcctccgctgctccacctcct
ccctatcagctaattaatcttccaccacacctggaaactgttggcatccaggaggatcct
caagactacctcttgctaatcaactgtcaaagcaagaagcctgaacccaccagaacacat
gctgattctgcaaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggagtgaatggcttttttcagcagcaaatg
atgtatgactctccaccgtctcgtgctgcatctgtttctgtagactccagcctttataac
ctgcccagaagttactcccacgatgttttaccaaaggtgtctccatcaagtaccgaggca
gatggagaactctatgtttttaataccccatctgggacatcaagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaactttgggacagacgtcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccggctcatgaccgatcgcctgtggaaacgtgt
agtatcacacgcacggcctcagatactgacagtagttactgtatccctacagcagggatg
ccaccatcacgtagtaataccatttccactgtggatttgaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgaacatttccaagtgacagatctagttcactt
gaaggcttccataaccactttaaaatcaaaaatatattgacagtgggaagtgtatcaagt
gaagaactggatgaaaattatgtcccaatgaatcccaattctcctccacgacaacattcc
agcagttttacggaaccaattcaggaagcaaattatgtgccaatgactccgggaacattt
gatttttcttcgtttggaatgcaagttcctcctccagctcatatgggcttccggtccagc
ccaaagacccctccccgcaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagcccgacagaaaagccaagccagcacctttagaaataaaacctttgcca
gaatgggaagaactgcaagccccagttagatctcctatcactaggagttttgctcgagat
tcctctagatttcccttgtctccccgaccggattcagtgcatagcacaacttcaagcagt
gactcacacgacagtgaagagaattatgttcccatgaacccaaacctatccagcgaagac
tcaaatctttttggcagtaacagccttgatgggagaagcagtcctatggtcaagcccaaa
ggagacaaacaagtagaatacctagatctggatttagattctgggaaatccacaccacca
cgtaagcaaaagagcagtggctcaggcagcagtgtagctgatgagagagtagattatgtt
gtggttgaccaacagaagactctggctctaaagagcactcgggaagcctggacagatggg
agacagtccacagaatctgaaacaccagccaagaatgtgaaatga

DBGET integrated database retrieval system