KEGG   Felis catus (domestic cat): 101088331
Entry
101088331         CDS       T02385                                 
Symbol
STX18
Name
(RefSeq) syntaxin-18
  KO
K08492  syntaxin 18
Organism
fca  Felis catus (domestic cat)
Pathway
fca04130  SNARE interactions in vesicular transport
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    101088331 (STX18)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088331 (STX18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088331 (STX18)
Membrane trafficking [BR:fca04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    101088331 (STX18)
SSDB
Motif
Pfam: Syntaxin-18_N Phage_CP76 DUF6279 TipAS Med11 DUF6176 RRF
Other DBs
NCBI-GeneID: 101088331
NCBI-ProteinID: XP_003985557
UniProt: M3XAH6
LinkDB
Position
B1:complement(201625581..201760430)
AA seq 335 aa
MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRPKSDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQTFMRTCSEAIQQLRTQAHK
EIHSQQVKEHRSAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPRTKTRES
VSSEKVSRDPSQDSEEKSVTEEYPEKVPAESQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWVLFFLVMCSFSLLFLDWYDS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcggtggatatcacgctgctgttccgggccagcgtcaagaccgtgaagacgcgcaac
aaagccctgggagtggcggtgggcggcggggctgacggcagccgcgacgagctgttccgc
cggagcccccggcccaagagcgacttctccagccgggcgcgggaagtgatttcacacatt
ggcaaactgagagattttctcctggaacacaggaaagattacattaatgcttatagccac
atcatgtctgagtacgggaggatgacagacacagagcgagaccagatagaccaggacgct
cagacgttcatgaggacctgctctgaagcgattcagcaactgcgaacacaagcccacaag
gagatacactcccagcaagtgaaggagcacaggagtgccgttctggatttcattgaagat
tacttgaaaagagtttgtaaactttactcagaacaaagagccatccgagttaagcgagtg
gtggataagaagagactatctaagctggaaccggaaccaaggacaaagaccagggaatcc
gtgtcttctgagaaagtttcacgggatccttcgcaagactctgaagaaaaatctgtcact
gaagaatatccagaaaaggttccggctgaatcccaacccgaattgggcacgtggggagac
ggcaaaggtgaagacgaattatccccagaagaaatacagatgtttgaacaagagaaccag
cgcctaattggtgagatgaacagcctgttcgatgaagtgaggcaaatcgaagggagagtg
gttgaaatttccaggctccaagaaatattcacagagaaggttttacaacaggaagccgag
atcgacagcattcaccagttagttgtaggggcgactgagaatatcaaggagggcaacgaa
gacatcagagaggccatcaaaaacaacgccggcttccgagtgtgggtgctcttcttcctg
gtgatgtgctccttctccttgctcttcctggactggtacgacagctag

DBGET integrated database retrieval system