KEGG   Felis catus (domestic cat): 101088344
Entry
101088344         CDS       T02385                                 
Symbol
EP300
Name
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04350  TGF-beta signaling pathway
fca04520  Adherens junction
fca04630  JAK-STAT signaling pathway
fca04720  Long-term potentiation
fca04916  Melanogenesis
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca04935  Growth hormone synthesis, secretion and action
fca05016  Huntington disease
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05211  Renal cell carcinoma
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    101088344 (EP300)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101088344 (EP300)
   04330 Notch signaling pathway
    101088344 (EP300)
   04350 TGF-beta signaling pathway
    101088344 (EP300)
   04630 JAK-STAT signaling pathway
    101088344 (EP300)
   04066 HIF-1 signaling pathway
    101088344 (EP300)
   04068 FoxO signaling pathway
    101088344 (EP300)
   04024 cAMP signaling pathway
    101088344 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101088344 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101088344 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101088344 (EP300)
   04935 Growth hormone synthesis, secretion and action
    101088344 (EP300)
   04919 Thyroid hormone signaling pathway
    101088344 (EP300)
   04916 Melanogenesis
    101088344 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    101088344 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088344 (EP300)
   05206 MicroRNAs in cancer
    101088344 (EP300)
   05203 Viral carcinogenesis
    101088344 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101088344 (EP300)
   05215 Prostate cancer
    101088344 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088344 (EP300)
   05161 Hepatitis B
    101088344 (EP300)
   05164 Influenza A
    101088344 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088344 (EP300)
   05165 Human papillomavirus infection
    101088344 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088344 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101088344 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101088344 (EP300)
   03036 Chromosome and associated proteins [BR:fca03036]
    101088344 (EP300)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101088344 (EP300)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101088344 (EP300)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101088344 (EP300)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101088344 (EP300)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101088344 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ RING_CBP-p300 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101088344
NCBI-ProteinID: XP_003989337
Ensembl: ENSFCAG00000005002
LinkDB
Position
B4:136643007..136723906
AA seq 2425 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPTMGMNTGMNAGMNPGMLN
AGNGQGMIPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIQTKSVLPNSLPPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQTQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGMNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVTSQTIPEKQPSQEVKMEAKMEVDQPEPADTQPEDIPETKAEDCKMEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPQPPSQPQPTPPNSMPPYLPRTQAPGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPS
GHLEPGMGPTGMQQQPPWAQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNMAPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNQ
QPLPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMPNMNPMQAGVQRAGLPQQQPPQQQLQP
PMGGMSPQAQQMNMNHNAMPSQFRDLLRRQQMMQQQQQQQQGAGPGIGPGMANHNQFQQP
QGVGYPPPQQQQQQQQRMQHHMQQMQQGNMGPMGQLPQTLGAEAGASLQAYQQRLLQQQM
GSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSP
RMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAS
ATDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7278 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctctttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagttcaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggcagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatgggaatgggcact
agtggaccaaatcagggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
caacctaccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgctgaat
gcaggcaatggacaggggatgatacccaatcaagtcatgaacggttcaattggagcaggc
cgagggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaatttaatg
actgagccactacagcaaggctctcctcagatgggaggacaaacaggattgaggggcccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccagtggccttggtctccagattcagacaaagtctgta
ctaccaaatagcttacctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaggtccagcagccaggcctcgtgactccggta
gcccaagggatgggttctggagcgcacacggctgatccagagaagcgcaagctcatccag
cagcagctcgtgctcctgttgcacgcccacaagtgccagcgccgcgagcaggctaatggg
gaagtaaggcagtgcaaccttccccactgtcgcacgatgaagaacgtcctgaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacgaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcagcagtctacccccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagggcctatgcagctcttgggctgccctatcaagtaaatcag
atgccgacgcaaccccaggtgcaagcaaagaaccagcagactcagcagtctggccagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacatcgaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctaggtcctatgccaacagca
gctcaaccatctaatactggaattcggaaacagtggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaactagttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacttggttgcatatgcccggaaagtggaaggagacatg
tacgaatctgcaaataatcgggccgaatactaccacctgctagctgagaaaatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctacca
agtgctgcaggcatggtaccagtttctatgaatccagggcctaatatggggcagccacaa
ccaggaatgacttctaatggccctctgcctgacccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtatgaatcaatttggccagatgagt
atgccccagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccaccaatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaggcaccggtgtctcaagcacagatgtccagttct
tcctgccctgtgaattctcctataatgcctccagggtctcaggggagccacattcactgt
ccccctctccctcaatcagctctgcatcagaattcaccctctccagtacctagtcgcacc
cccacgcctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagccccggttcctacacctccagccatgccgcctgggccacagacccaagctctccat
ccacctccaaggcagacacctacaccgccaccaacgcaactccctccccaagttcaacct
tcacttcctgctgccccttccgccgaccagccgcagcagcagcctctctcacagcagagt
acagcagcatctgttcccaccccaacggcaccgctgctgcctccgcagcctgcgactcca
ctttcccagccagctgtaagcattgaagggcaggtatcaaaccctccatctactagcagc
acagaagtgacttctcagaccattcctgagaagcagccttcacaggaagtgaaaatggag
gccaagatggaagtggatcagccagaaccagcagatactcagccggaggacatcccagag
actaaagcagaagactgtaaaatggaacctacagaaacagaggagagaggcacggagtta
aaaactgaaacaaaagaagaggaagaccagccgagtacttcggctacccagtcatctcca
gccccgggacagtcaaagaagaagatttttaaaccagaagagttacgacaggcactgatg
ccaacattggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gaccctcaacttctaggaatccctgattactttgatattgtgaaaagccccatggatctt
tccaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtctttgaacaagaaattgacccagtaatgcaaagc
cttggatattgttgtggcagaaagttggagttctctccacagacactgtgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactg
gatcctgaactatttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtc
cttcatcatgaaatcatttggccatctggatttgtctgcgatggctgtttaaagaaatct
gcacgaaccaggaaagagaataaattttctgctaaaaggttgccatctaccaggcttggc
acctttctggagaatcgtgtgaatgactttcttaggcgacaaaatcaccctgagtcagga
gaggtcactgttcgggtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagcc
ctctttgcctttgaagagatagacggtgttgacttatgtttctttggcatgcacgttcaa
gagtatggctctgactgccctccgcccaaccagaggagagtttacatatcatacctcgac
agtgttcatttcttccgtcctaaatgcttgaggaccgcagtgtatcatgaaattctaatt
ggatatttagaatacgtcaagaaattaggatatacaacagggcatatttgggcatgtccc
ccgagcgagggagatgactatatcttccattgccatcctcctgaccagaagataccgaag
cccaagcgactgcaggagtggtataaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaag
gagttgccttactttgagggtgatttctggcccaatgttctggaagagagcattaaagaa
ctggaacaggaggaggaagagagaaagagagaagaaaacaccagcaatgaaagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctcagtaggggcaacaagaagaagccaggcatgcccaatgtgtccaacgac
ctctcgcagaagctgtatgccacaatggaaaaacacaaagaggtcttctttgtgatccgt
ctcatcgccggccctgccgccaactccctgcctcccattgttgaccctgaccccctcatc
ccctgcgatctgatggatgggcgggatgccttccttaccctcgccagggacaagcacctg
gagttctcttcactgcgcagagcccagtggtccaccatgtgtatgctggtggagctgcac
acccagagccaggaccgctttgtctacacgtgcaacgagtgcaagcaccacgtggagacg
cgctggcactgcaccgtgtgcgaggattacgatctgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctcggcctagatgacgagagcaacagccag
caggccgcggccacccagagcccaggagactctcgccgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtcgtgcagcacaccaagggctgcaagcggaaaaccaacggaggctgc
cccatctgcaagcagctcatcgccctgtgctgctaccacgccaagcactgccaggagaac
aagtgcccggtgcccttctgcctcaacatcaagcaaaagctccggcagcagcagctgcag
caccggctgcagcaggcccagatgctccgcaggaggatggccagcatgcagcggaccggc
gtggtggggcagcaacaaggcctgccctccccgactcccgccacgcccaccacgcccacc
ggccagcagcccaccaccccgcagacgccccagccccagcccccctctcagccccagcct
acccctcccaacagcatgccaccctacttgcctaggactcaggctcctggccctgtctcc
cagggtaaggcggcgggccaggtgacccctccgaccccccctcagactgctcagccaccc
cttccggggcccccacctgcggcagtggaaatggcaatgcagattcagagggcggctgag
acgcagcgccagatggcccacgtgcaaatttttcagaggccaatccagcaccagatgccc
cagatgactccgatggcccccatgggtatgaacccaccccccatggccagaggtcccagt
gggcatttggagccagggatggggcccacgggcatgcagcaacagccgccgtgggcccaa
ggaggcttgcctcaaccccagcaactacagcccgggatgccgaggccggccatgatgtca
gtggcccagcacggtcagcccttgaatatggctccccaaccgggactgggccaggtaggc
gtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaac
ccccagctgttggccgcgttcatcaagcagcgggctgccaagtatgccaactctaaccaa
cagcccctccccgggcagcctggcatgccccagggccagccggggctgcagccacctacc
atgccgggccagcagggcgtccactctaatccggccatgccgaacatgaaccccatgcag
gcaggcgtccagagggccggcctgccgcagcagcagccaccgcagcagcagctccagcca
cccatgggagggatgagcccccaggctcagcagatgaacatgaatcacaacgccatgcct
tcacagttccgagacctcttgagacggcagcagatgatgcagcagcagcagcagcagcag
cagggagccgggcccggaatcggccctggaatggccaaccacaaccagttccagcaaccc
cagggagttggctaccccccaccgcagcagcagcagcagcagcagcagcggatgcagcat
cacatgcaacagatgcaacaagggaacatgggaccgatgggccagctcccccagaccttg
ggagccgaggcaggagccagtctgcaggcgtatcagcagcgactcctccagcaacagatg
gggtcccccgctcagcccaaccccatgagcccccaacagcatatgctcccaaaccaggct
cagtccccacacctccaaggccagcagatcccttcttctctctccaatcaagtgcgttca
ccccagcctgtcccttctccgcggccacagtcccagcccccccactccagcccttccccg
aggatgcagcctcagccttctccacaccacgtgtccccacagaccagttctccacatcct
ggactggtagctgcccaggccaaccccatggaacaagggcattttgccagcccggaccag
agttcaatgctttctcagctcgctagcaatccaggcatggcaaacctccatggtgcaagc
gccacggacctgggactcagcaccgataactcagacttgaattcaaacctctcacagagt
acactagacatacactag

KEGG   Felis catus (domestic cat): 101094471
Entry
101094471         CDS       T02385                                 
Symbol
CREBBP
Name
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04350  TGF-beta signaling pathway
fca04520  Adherens junction
fca04630  JAK-STAT signaling pathway
fca04720  Long-term potentiation
fca04916  Melanogenesis
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca04935  Growth hormone synthesis, secretion and action
fca05016  Huntington disease
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05211  Renal cell carcinoma
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    101094471 (CREBBP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101094471 (CREBBP)
   04330 Notch signaling pathway
    101094471 (CREBBP)
   04350 TGF-beta signaling pathway
    101094471 (CREBBP)
   04630 JAK-STAT signaling pathway
    101094471 (CREBBP)
   04066 HIF-1 signaling pathway
    101094471 (CREBBP)
   04068 FoxO signaling pathway
    101094471 (CREBBP)
   04024 cAMP signaling pathway
    101094471 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101094471 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101094471 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101094471 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    101094471 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101094471 (CREBBP)
   04916 Melanogenesis
    101094471 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    101094471 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094471 (CREBBP)
   05206 MicroRNAs in cancer
    101094471 (CREBBP)
   05203 Viral carcinogenesis
    101094471 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101094471 (CREBBP)
   05215 Prostate cancer
    101094471 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094471 (CREBBP)
   05161 Hepatitis B
    101094471 (CREBBP)
   05164 Influenza A
    101094471 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094471 (CREBBP)
   05165 Human papillomavirus infection
    101094471 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101094471 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101094471 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094471 (CREBBP)
   03036 Chromosome and associated proteins [BR:fca03036]
    101094471 (CREBBP)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101094471 (CREBBP)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094471 (CREBBP)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101094471 (CREBBP)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101094471 (CREBBP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101094471 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ RING_CBP-p300 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101094471
NCBI-ProteinID: XP_023102362
Ensembl: ENSFCAG00000006262
LinkDB
Position
E3:41366296..41495893
AA seq 2454 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLINSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPALLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGASSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMAGNTSPFGQPFSQTGGQQMGAPGVNPQLSSK
QSMVNSLPPFPTDIKNPSVTNVPNMSQMQTSVGIVPTQAITAGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQSHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSGSANLGTLSTIPTAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHS
NNIMAQAPAQNQFLPQNQFQSSGGAMSVSSVGLGQPAAQTGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPSAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQPGPEAPMLEMKAEVKTEDTEPDASESKGEP
GSAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVETKEEEESSANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADRYHFCEKCFTEIQGE
NVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFV
CDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDK
TVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTR
RVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCH
PPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPN
VLEESIKELEQEEEERKKEESSAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKK
PSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAF
LTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYD
LCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPA
QPQPSPVSMSPAGFPGVARTQPPTTVSAGKPANQVPAPPPPAQPPPAAVEAARQIEREAQ
QQQHLYRVNINNGVPPGRTGMVTPVGQMAPAGLNVPRPGPVSGPVVPNLPPGQWQQAPLP
QQQPMPGMPRPVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVL
NILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQPQPGLQPQPGLQPQQPGLQNLNAMQ
AGGPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQ
QPPPPPPPQGGAGMAGGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQM
GQLGQMGQPGLGADGTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQAS
HLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLA
VTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7365 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaggccttataaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctgcgcggaggcagcggctct
agtatcaacccaggaataggaaatgttagcgccagcagccccgtgcagcaaggcctcggt
gggcaggctcaagggcagccgaacagtgcaaacatggccagcctgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccccagcctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaatgctaac
tttaaccagacccaccctgccctcctcaatagtaactctggccatagtttaatgaaccag
gcccagcaaggacaggcgcaagtcatgaatggctctcttggggcggccggcagaggaagg
ggagctgggatgccgtaccccgcgcccgccatgcagggggcctcgagcagcgtgttggcc
gagacgttaacgcaggtctcgccgcaaatggccagtcacgcgggactgaacacggcgcag
gcaggaggcatgaccaagatgggaatggctggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcaaatgggagcccctggagtgaacccccagttatccagcaaa
cagagcatggtcaatagtttgcctcccttccctacagacatcaagaatccttccgtcacc
aacgtgccaaacatgtctcagatgcaaacttcagtgggaattgtacccacacaagcgatc
acagcaggccccactgcagatcctgaaaagcgcaaactgatacagcagcagctggttcta
ctgcttcatgctcacaagtgtcagagacgagaacaagcgaacggagaagttcgggcctgc
tctctcccgcattgccgaaccatgaagaatgttttgaatcacatgacacactgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtgggattcagaacacgatcggttctgtc
ggcaccggccagcagaacgccgcttcgctgagtaacccgaatcccatagaccccagctcc
atgcagcgcgcgtatgctgcccttggtctcccctacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcaaagtcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccgccaaacttgatttcagaatcagctcttccaacttccctcggggccacaaaccca
ctgatgaacgatggctcaggctctgcaaacctcgggaccctcagcactatacccacagcg
gcacctccttccagcaccggcgtgcggaaaagctggcacgaacatgtcactcaggacctg
cggagccacctagtgcataaactggtccaagccatcttcccaacccctgacccggcagcc
ctgaaggatcgccgcatggagaacctggtggcctatgctaagaaagtggagggggacatg
tatgagtccgccaacagcagggatgaatactatcacttactggcagaaaaaatttacaag
atacaaaaagaactagaagaaaagcggaggtcacgtttacacaaacaaggcatcctgggt
aaccagcccgccctaccagcccccggggcacagccccctgggattccgcaggcacaacct
gtgaggcctccaaatggacccatgcccctgccagtgaatcgcgtgcaggtttctcaaggg
atgaattcatttaccccaatgtccttggggaacgtacagttgccgcaggctcccatggga
ccgcgtgcagcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgccccagcctccgaacatgatgggcgctcacagc
aacaacatcatggcccaggcgcctgcgcagaaccagttcctgcctcagaaccagttccag
tcctccggcggggcgatgagtgtgagcagcgtgggcctgggccagccggcggcccagacg
ggcgtgccgcagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
cctcaggccagccagctgccttgtccaccagtgacacagtcaccgttgcaccagacgcca
ccccctgcttccacggccgcgggcatgccgtctctccagcacccgtcggcgcctgggatg
actcctccccagccagcagctcccacccagccatcgactcctgtgtcgtcttccgggcag
acccctaccccgactcccggctcggtgcccagtgccagccagacccagagcaccccgacg
gtccaggcagcagcccaggcccaggtgaccccacagcctcagaccccagtccagcccccg
tctgtggccacccctcagtcatcacaacagcagccgacgcctgtgcatgcccagcctccc
ggcacaccgctttcccaggcagcagccagcatcgataaccgggtccccactccttcctcg
gtggccagcgccgaaaccaactcccagcagccaggacccgaggcaccgatgctggagatg
aaagcagaggtcaagactgaggacactgagcctgatgccagtgaatccaagggggagccg
gggtctgcgatgatggaggaggatctgcaaggatcttctcaagttaaagaagaaacagac
acaacagaacagaaatccgaaccgatggaagtggacgagaagaaaccggaagtcaaagta
gaaactaaagaggaagaagagagcagcgctaatggggccgcctctcagtcaacatctcct
tcacagccacgcaaaaaaatctttaagccggaagagttacgccaggctctgatgccaacc
ctggaagcgctgtaccgccaggacccggagtccttgcctttccggcagcctgtggacccc
cagctgctagggatcccggattattttgacattgtcaagaaccctatggacctttccacc
atcaagcggaagctggacacggggcagtaccaagaaccctggcagtatgtggatgacgtc
tggctcatgttcaacaacgcctggctctataaccggaagacgtcccgggtctataagttc
tgcagcaaacttgctgaggtctttgagcaggaaattgaccccgtcatgcagtcccttgga
tattgttgtgggcgcaagtatgagttttccccacagactttgtgctgctatgggaagcag
ctgtgtacaattcctcgcgacgctgcctactacagctatcagaacagttcacccaagtat
ggccttcttgctgacaggtatcatttctgtgagaagtgtttcacagagatccagggggag
aatgttaccctgggtgacgacccttcacaaccccagacgacaatttcaaaggatcagttt
gaaaagaagaaaaatgataccttagatcctgaaccttttgtcgattgcaaggagtgtggc
cggaagatgcatcagatttgtgttctgcactatgacatcatttggccttcgggcttcgtg
tgtgacaattgcctgaagaaaaccggcagaactcggaaagaaaacaagttcagtgcgaag
agactacagaccacgcgattgggcaaccacttggaagaccgagtcaacaagtttttgcgg
cgacagaatcatcccgaagccggggaggtctttgtccgggtggtggccagctcagacaag
actgtggaggtcaagcctgggatgaagtcacggtttgtggattccggggaaatgtctgaa
tctttcccgtatcgaaccaaagcactctttgcttttgaggaaattgacggagtggatgtg
tgcttctttggaatgcacgtgcaagagtacggctccgattgcccccctccaaacacaagg
cgtgtatacatatcttatctggacagtattcatttcttccggccccggtgcctccggacc
gctgtttaccatgagatccttattggatatttagaatacgtgaagaaattggggtacgta
acgggacacatctgggcctgccccccgagtgaaggagatgactatatcttccattgccac
ccccctgatcagaaaatccccaaaccaaagcgcctgcaggagtggtacaagaagatgctg
gacaaggcatttgcagaacggatcattcacgactacaaggacattttcaaacaagcgacc
gaagacaggctcaccagtgccaaggagctgccctattttgagggtgacttctggcccaat
gtgctggaggagagcattaaggagttggagcaagaagaagaagagaggaagaaggaggag
agcagtgcagccagcgagaccacggagggcagccagggtgacagcaagaatgccaagaag
aagaacaacaagaaaaccaataagaataaaagcagcatcagtcgagccaacaaaaagaag
cccagcatgcccaacgtgtccaacgacttgtcccagaagctctacgccaccatggagaag
cacaaagaggtcttctttgtgattcacctgcacgccgggcccgtcatcaacacactgccc
cccatcgtcgaccctgaccccctgctcagctgtgacctcatggacgggcgtgacgccttc
ctcacccttgccagagacaagcactgggagttctcgtccctgcgccggtccaagtggtcc
acgctgtgcatgctggtggagctgcacacacagggccaggaccggtttgtctacacctgc
aacgagtgcaagcaccacgtggagacgcgctggcactgcaccgtgtgcgaggactacgac
ctgtgcatcaactgctacaacacgaagagccacgcccacaagatggtgaagtgggggctg
ggcctggacgacgagggcagcagccagggcgagccgcagtccaagagcccccaggagtcg
cggcgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaac
gccaactgctcgctgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggc
tgcaagcgcaagaccaacgggggctgcccggtgtgcaagcagctcatcgccctctgctgc
taccacgccaaacactgccaggagaacaaatgcccggtgcccttctgcctcaacatcaaa
cacaagctccgccagcagcagatccagcaccgcctgcagcaggctcagctcatgcgccgg
cggatggccaccatgaacacccgcaacgtgcctcagcagagtctgccttcccctacctca
gcgccgcccgggacccccacgcagcagcccagcacgccccagacgccgcagccacccgcc
cagccccagccctcgcccgtgagcatgtcaccggccggcttccccggcgtggcccggact
cagccccccaccacggtgtccgccgggaagcccgccaaccaggtgccggccccgccgccc
cccgcccagcccccgccggccgcggtggaagcggcccggcagatcgagcgcgaggcgcag
cagcagcagcacctgtaccgggtgaacatcaacaacggcgtgcccccggggcgcacgggc
atggtgaccccggtgggccagatggcccccgcgggcctgaacgtgccccggcccggcccg
gtcagcgggcccgtcgtgcccaacctgccgcccgggcagtggcagcaggcgcctctcccc
cagcagcagccgatgccgggcatgcccaggcccgtgatgtccatgcaggcccagccggcc
gtggcagggcctcggatgcccagcgtgcagccgccccggagcatctcgcccggcgccctg
caggacctgttgcggaccctgaagtcgcccagctccccgcagcagcagcagcaggtgctc
aacatcctcaagtcaaacccccagctgatggcggctttcatcaagcagcgcacggccaag
tacgtggccagtcagcccggcctccagccccagcccggcctccagccccagcccggcctc
cagccccagcccggcctccagccccagcagcccggcctgcagaacctgaacgccatgcaa
gccggcgggccccggcccggcgtgcccccgcagcagcaggcgatgggaggcctgaacccc
cagggccaggccctgaacatcatgaacccggggcacaaccccagcatggcgagcatgaac
ccgcagtacagagagatgctgcgccggcagctgctgcagcagcagcaacagcagcagcag
cagccgccgccgccgccaccgccacagggcggcgcgggcatggcggggggcatggccggg
cacggccagttccagcagccccagggacccggaggctacccgccggccatgcagcagcag
cggatgcagcagcacctccccatccagggcagctccatgggccagatggcggctcagatg
ggacagctcggccagatggggcagcccgggctgggcgcggacggcacccccaacatccag
caggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatcgggtccccg
ggccagccgaaccccatgagcccccagcagcacatgctctcaggacagccccaggcctcg
cacctcccgggccagcagatggccacgtccctcagtagccaggtgcggtccccggcccct
gtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggatccag
ccccagccttcgccgcaccacgtctcgccccagaccggttccccccacccaggactcgcg
gtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatg
ctcccccagctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggc
gacaccacaggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system