KEGG   Felis catus (domestic cat): 101088702
Entry
101088702         CDS       T02385                                 
Symbol
HGS
Name
(RefSeq) hepatocyte growth factor-regulated tyrosine kinase substrate isoform X1
  KO
K12182  hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04144  Endocytosis
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    101088702 (HGS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101088702 (HGS)
   04145 Phagosome
    101088702 (HGS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088702 (HGS)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101088702 (HGS)
SSDB
Motif
Pfam: VHS Hrs_helical FYVE FYVE_2 UIM MnmE_helical
Other DBs
NCBI-GeneID: 101088702
NCBI-ProteinID: XP_003997318
Ensembl: ENSFCAG00000012926
LinkDB
Position
E1:62146103..62160688
AA seq 780 aa
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVSSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKH
HCRACGQIFCGKCSSKSSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTAELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSAYAAATYPKAEPAPVA
SSAPPASSLYSSPVTSSAPLAEDIDPELARYLNRNYWEKKQEESRKSPTPSAPAPLTEPA
APPAEGHTVPASALETPLPETDSQPVAPSSGPFGEQFQNGESEESHAQFLKALQNAVTTF
VNRMKSNHVRGRSITNDSAVLSLFQSINSMHPQLLELLNQLDERRLYYEGLQDKLAQIRD
ARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQ
EKERQMRLEQQKQTIQMRAQMPAFSLPYAQLQAMPAAGGVLYQPSGPTSFPGTFSPAGSV
EGSPMHTVYMSQPAPAAGSPYPGMPGAGADPGMVSAYMYPAGAAGAQAAPQGPAGPTASP
AYSSYQPTPTQGYQNVASQAPQSLQAISQPPQSGAMGYMGSQSVSMGYQPYSMQNLMNTL
PSQDTPMPPPQQPYISGQQPMYQQMAPSGGPPQQPPPVAQQPPAQGPPAQGSEAQLISFD
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggggcgcggcagcggcaccttcgagcgtctcctagacaaagctaccagccagcttctg
ctggagaccgactgggaatccatcctccagatctgtgacctcatccgccagggggacaca
caagcaaaatacgcagtgagttctatcaaaaagaaagtcaacgacaagaatccccacgtg
gccttgtatgccctcgaggtcatggagtctgtggtgaagaactgtggccagacggtccac
gatgaggtggccaacaagcagactatggaggagctgaaggagctgttgaagaggcaggtg
gaggtaaatgtccgaaacaagattctgtatctgatccaggcctgggcgcatgctttccgg
aatgagcccaagtacaaggtggtccaggacacgtaccagatcatgaaggtggaaggacac
gtgttcccggagtttaaggagagcgatgccatgtttgctgcagagagagcccccgattgg
gtggatgccgaagagtgccaccgctgccgggtgcagttcggggtggtgacccgcaagcac
cactgccgggcgtgcggccagatcttctgcggcaagtgctcctctaagtcctccaccatc
cccaagttcggcatcgagaaggaggtgcgcgtgtgcgagccctgctacgagcagctgaac
aagaaagcagaaggaaaggcgtcgtccacagcggagctgcccccagagtacctgaccagc
cccctgtcccagcagtcccagctgccccccaagcgggacgagacggccctgcaagaggag
gaggagttgcagctggccctggccctgtctcagtcagaggctgaggagaaggagaggatg
agacagaagtctgcctacgccgctgccacataccccaaagcagaacccgcgcccgtggcc
tcgtcggcgccccctgccagcagcctgtactcctcgccagtgacctcgtcggcacctctg
gctgaggacatcgaccctgagcttgcccggtacctcaaccggaactactgggagaagaag
caggaggagtcccggaagagccccacgccgtctgcccccgcgcccctgacggagccggct
gccccgcccgcggaggggcacacagtccctgccagtgcactggagacgcccctcccggag
acagactctcagcctgtggccccctccagcggcccctttggcgagcaattccagaacggg
gagtcggaggagagccacgcgcagtttctgaaggccctgcagaacgccgtcaccaccttt
gtcaaccgcatgaagagcaaccacgtgcgcggccgcagcatcaccaacgactcggccgtg
ctgtccctgttccagtccatcaacagcatgcaccctcagctgctggaactgctcaaccag
ctggacgagcgcaggctatactacgaggggctgcaggacaagctggcgcagatccgcgat
gcccggggggccctcagcgccctgcgggaagagcaccgggagaagcttcgccgggcagct
gaggaagccgagcgccagcgccagatacagctggcccagaagctggagatcatgcggcag
aaaaagcaggaatacctggaggtacagcggcagctggccatccagcgcctgcaggagcag
gagaaggagcgccagatgcgcctggagcagcagaagcagaccatccagatgcgggcccag
atgcccgccttctccctgccctacgcccagctccaggccatgcccgcggccgggggcgtg
ctctaccagccctccggcccaaccagcttcccaggcaccttcagcccagcaggctcggtg
gagggctcccccatgcacaccgtgtacatgagccagccggcgcccgccgccggcagcccc
taccccggcatgcccggggccggagcagatcccggcatggtgagcgcctacatgtaccca
gcaggagccgccggtgcgcaggcggccccccagggcccggccggacccaccgccagccca
gcctactcctcctatcagcccacccccacgcagggctatcagaacgtggcctcccaggcc
ccacagagcctccaggccatctcccagcctccacagtccggtgccatgggttacatgggg
agccagtcggtgtccatgggctaccagccgtacagcatgcagaacctcatgaacaccctt
cccagccaggacacaccgatgccgcccccacagcagccctacatctcagggcagcagccc
atgtaccagcagatggcgccctcggggggacccccccagcagccgccccccgtggcccag
cagccgccggcacagggccctccggcacagggcagcgaagcccagctcatctcctttgac
tga

DBGET integrated database retrieval system