KEGG   Felis catus (domestic cat): 101088852
Entry
101088852         CDS       T02385                                 
Symbol
PFKM
Name
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00030  Pentose phosphate pathway
fca00051  Fructose and mannose metabolism
fca00052  Galactose metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca03018  RNA degradation
fca04066  HIF-1 signaling pathway
fca04152  AMPK signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101088852 (PFKM)
   00030 Pentose phosphate pathway
    101088852 (PFKM)
   00051 Fructose and mannose metabolism
    101088852 (PFKM)
   00052 Galactose metabolism
    101088852 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101088852 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101088852 (PFKM)
   04152 AMPK signaling pathway
    101088852 (PFKM)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101088852 (PFKM)
   04919 Thyroid hormone signaling pathway
    101088852 (PFKM)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101088852 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101088852 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101088852 (PFKM)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101088852 (PFKM)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101088852 (PFKM)
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101088852 (PFKM)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 101088852
NCBI-ProteinID: XP_006933715
Ensembl: ENSFCAG00000014004
LinkDB
Position
B4:76992778..77037962
AA seq 782 aa
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKTGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQMTKDVTK
AMNDRKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKGPSSIHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVHKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKEQTDFDHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEA
SI
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccatcgccgtg
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatctttactggtgcccgtgtgttctttgtccatgagggttatcaaggcctggtggat
ggtggagataacatcagggaagccacctgggagagtgtttcgatgatgcttcagctggga
ggcacagtcattggaagtgcccggtgcaaggacttccgtgaacgagagggacgactccgc
gctgcccacaacctggtgaagcgtgggattactaatctgtgtgtcatcgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttactgagtgacctccag
aaagcgggtaagatcacagcggaggaggctacgaagtccagctatctgaatatcgtgggt
ttggtgggctcaattgacaatgacttttgtggcactgatatgaccattggcactgattcc
gccctgcaccggatcatagagattgtggacgccatcaccaccactgctcagagccaccag
aggacgtttgtgctagaagtgatgggccggcactgtggatacctggcccttgtcacctcc
ctctcctgtggggctgactgggtttttattcctgagtgtccaccggatgacgactgggag
gaacatctttgtcgccggctcagtgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgccatcgacaagactgggaaacccataacctcagaagacatcaag
aatctggtggtgaagcgtctgggatatgacacccgggtcactgtcttggggcatgtgcag
cggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaggca
gtgatggcacttttggaagggactccagacaccccagcctgtgtggtgagcctctctggg
aaccaggctgtgcgcctgcccctcatggagtgtgtccaaatgaccaaagatgtgaccaag
gccatgaacgacaggaaatttgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaagtgtacaagcttctggctcatgtcagacccccagtctctaagggaccgagt
agcatacacacagtggccgtgatgaacgtgggggcccccgccgcaggcatgaacgctgcc
gtccgttccaccgtgaggattggcctcatccagggcaaccgggtgctggttgtacatgat
ggcttcgagggcctggccaagggtcagatcgaggaagctggctggagctatgttgggggc
tggactggccaaggtggttccaaacttgggactaaaaggactctacccaagaagagcttt
gagcagatcagtgccaacatcactaagtttaacattcagggccttgtcatcattgggggc
tttgaggcttacacagggggcctggaactgatggagggcaggaagctgtttgacgagctg
tgcatcccgtttgtggtcatccccgcgacggtctccaacaacgtccccggctcggacttc
agcgtgggggctgacacagcactcaatactatctgcacgacctgtgaccgcatcaagcag
tcagcggcaggcaccaagcgtcgggtgtttatcatcgaaacgatgggtggctactgtggc
tacctggccaccatggcaggactggcagctggggccgatgccgcctacatttttgaggag
cccttcaccattcgggacctgcaggcaaatgttgaacatctggtgcataagatgaaaacc
actgtgaaaaggggcttggtattaaggaatgagaagtgcaatgagaactacaccacggac
ttcatcttcaacctgtactctgaggaggggaagggcatatttgacagcaggaagaatgtg
cttgggcacatgcagcagggtggaagcccaactccgtttgacagaaattttgccactaag
atgggtgccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatggg
aggatcttcgccaatacaccagactcaggctgtgttctggggatgcgtaagagggctctg
gtctttcaaccggtgactgagctgaaggagcagacggattttgaccaccgcatccccaag
gagcagtggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgac
ttggacacctcagagcacgcccacctggagcacatcagccggaagcgatctggagaagct
tctatctaa

KEGG   Felis catus (domestic cat): 101090792
Entry
101090792         CDS       T02385                                 
Symbol
PFKL
Name
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00030  Pentose phosphate pathway
fca00051  Fructose and mannose metabolism
fca00052  Galactose metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca03018  RNA degradation
fca04066  HIF-1 signaling pathway
fca04152  AMPK signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101090792 (PFKL)
   00030 Pentose phosphate pathway
    101090792 (PFKL)
   00051 Fructose and mannose metabolism
    101090792 (PFKL)
   00052 Galactose metabolism
    101090792 (PFKL)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101090792 (PFKL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101090792 (PFKL)
   04152 AMPK signaling pathway
    101090792 (PFKL)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101090792 (PFKL)
   04919 Thyroid hormone signaling pathway
    101090792 (PFKL)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101090792 (PFKL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101090792 (PFKL)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101090792 (PFKL)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101090792 (PFKL)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101090792 (PFKL)
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101090792 (PFKL)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 101090792
NCBI-ProteinID: XP_019694868
Ensembl: ENSFCAG00000003311
LinkDB
Position
C2:complement(2182780..2209493)
AA seq 751 aa
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTVIGSARC
QAFTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRREWGSLLEELVAAGKISEST
AQTYSHLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMG
RHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDR
NGKPISSRYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATP
DTQACVVSLSGNQSVRLPLMECVQVTKEVQKAMDEKRFDEAIQLRGRSFENNWNIYKLLA
HQKVSTEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQGHTVYVVHDGFEGLAKGQVQE
VSWHDVAGWLGRGGSMLGTKRTLPKSYMQKVVENIRTYNIQALLVIGGFEAYEGVLQLVE
ARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIV
ETMGGYCGYLATVTGIAVGADAAYVFEDPFNIQDLKANVEHMTEKMKTHIQRGLVLRNEK
CHEHYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSEK
LRAVYRNGRVFANAPDSACVIGLQKKAVAFSPVTELKKDTDFEHRMPREQWWLNLRLMLK
MLAHYRISMADYVSGELEHVTRRTLSIDKGF
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgaacgcggctgtcagagctgtgacgcgcatgggcatctacgtgggagccaaagtcttc
cttatctacgagggctacgagggcctcgtggaaggaggcgagaacattaagcaggccaac
tggctcagcgtgtccaacatcatccagctgggcggcacggtcatcggcagtgcccgctgc
caggccttcaccacgcgggaggggcgcctggcggcggcctacaacctggtccagcgtggc
atcaccaacctgtgtgtcatcggcggggacggcagcctgacgggcgccaacatcttccgc
cgcgagtggggcagcctgctggaggagctggtggcagcaggcaagatctcggagagcacg
gcgcagacctactcgcacctgaacatcgtggggctggtgggctccatcgacaacgacttc
tgcggcaccgacatgaccatcggcacggactcggccctgcaccgcatcatggaggtcatc
gacgccattaccaccactgcccagagccaccagaggacctttgtgctggaggtgatgggg
cggcactgtgggtacctggccctggtgtccgccctggcctcgggggctgactggctgttc
atccctgaggcgccccccgaggacggctgggagaacttcatgtgtgagagacttggggag
actcggagcagagggtcccgactgaacatcatcatcatcgcggagggcgccattgaccgt
aacgggaagcccatctcgtcccgttatgtgaaggacctggtggtccagaggctgggcttc
gacacccgtgtgactgtgctgggccacgtgcagaggggagggaccccttcggcgtttgac
cgcatcctgagcagcaagatgggcatggaggcggtgatggcgcttctggaggccactccc
gacacgcaggcctgcgtggtcagcctgtcggggaaccagtccgtgcggctgcccctcatg
gagtgtgtgcaggtgacaaaggaggtacagaaggccatggatgagaagaggttcgacgag
gccatccagctccgtggcaggagctttgagaacaactggaacatttacaagctgctcgca
caccagaaggtctccacagagaagaccaacttctccctggccatcctgaacgtgggcgcc
ccggcggccggcatgaatgcggctgtgcgctcggcggtgcggtctggcatctcccagggc
cacacggtgtatgtcgtgcacgatggctttgaaggcctggccaagggtcaggtacaggaa
gtgagttggcacgatgtggccggctggctgggccgtggcggctccatgctggggaccaag
aggacgctgcccaagagctacatgcagaaggtagtggaaaacatccgtacctacaacatc
caggccctgctagtcatcggcggctttgaggcctacgagggggtgctgcagctagtggag
gcacgtgggcgctacgaggagctctgcattgtcatgtgcgtcatcccggccaccatcagc
aacaacgtaccgggcaccgacttcagcctgggatcggacaccgccgtcaacgccgccatg
gagagctgtgaccgcatcaagcagtcggcctcggggaccaagcgccgcgtgttcatcgtg
gagaccatggggggctactgcggctacctggccactgtgacgggcatcgccgtgggggcc
gacgccgcctacgtcttcgaggaccctttcaacatccaagacttaaaagccaacgtggag
cacatgaccgagaagatgaagacacacatccagaggggcctggtgcttcgaaacgagaag
tgccatgaacactacaccacggagtttctgtataacctgtactcctccgaggggaagggc
gtctttgactgcaggaccaacgtcctgggccacctgcagcagggcggagctccgaccccc
tttgaccggaactacggtacgaagcttggggtgaaggccatgctctggatgtcggagaag
ctgcgcgccgtctaccgtaatgggcgggtgttcgccaacgcccccgactcagcctgtgtg
atcggcctgcagaagaaggcggtggccttcagccccgtcaccgagctcaagaaggacacc
gactttgagcaccgcatgccgcgggagcagtggtggctgaacctgcggctcatgttgaag
atgctggcgcattaccgcatcagcatggccgactacgtgtccggggagctggagcacgtc
acccgccgcaccctcagcatcgacaagggcttctga

KEGG   Felis catus (domestic cat): 101097072
Entry
101097072         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00030  Pentose phosphate pathway
fca00051  Fructose and mannose metabolism
fca00052  Galactose metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca03018  RNA degradation
fca04066  HIF-1 signaling pathway
fca04152  AMPK signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101097072
   00030 Pentose phosphate pathway
    101097072
   00051 Fructose and mannose metabolism
    101097072
   00052 Galactose metabolism
    101097072
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101097072
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101097072
   04152 AMPK signaling pathway
    101097072
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101097072
   04919 Thyroid hormone signaling pathway
    101097072
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101097072
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101097072
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101097072
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101097072
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101097072
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101097072
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 101097072
NCBI-ProteinID: XP_023105379
Ensembl: ENSFCAG00000003235
LinkDB
Position
B4
AA seq 1038 aa
MNAAVRAVVRMGIYVGAKXYFIYEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARC
KAFRTREGRLKAAGNLVQRGITNLCVIGGDGSLTGANIFRKEWSGLLKELAENGTSVRPP
VPRGIFCSLRSFAVPLGALRTHASAQLTVAWRLEVRVRVSTTPCVRLCRGPPGVCLVARL
EVTCSRGPSVFHGPYLGRVLMRRIEMGILGCGVDLSPDPGRSPGGVWAAVVDLSPTLVGG
LAAVWASVPTPGVPWWAVWAAVWASVPTLEVPDLSLTPGGPLVGVWAACGPQSRPQEVHW
WAFWAGGVDLSPTLVGVLGLRWAFWLRCGPQSPTPGGPLVGVWLRVDLSPNPGGRLGCGV
GLSPTPGGPLVGFLGCSVGLSPDPRRSTGGRSGCGVDLSPTLVGVLGLRISPGRRLQENM
CVKLSEYARPGFPASRRSVTRSSRDGCSRGISAGDGLGGTPWECGLLKRGGCGDNRCGLS
ARLDRVLHENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLVESCARWXTQDV
QKAMDERRFKDAVRLRGRXLSRGNLNTYKRLAIKMPDDQIRKWVPPRSNCNVAVINGGRP
PAAGMNAAVRSXVRVGISKGTRCLTIYDGFEGLRQGQVIKEIGWADVGGWMDRRRGYILG
TKRTLPGKSLEAIAEQMRTHSINALLIIGGFEVRAPDTAYLGLLELSAAREKYEELCVPM
VMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLAN
MGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRNESCSEHYTTDFIYH
LYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISTKLKEAQGKGKRFV
TDDCICVLGISKRNLLFQPVAQLKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYEVSD
PGQLEHVHHRGHEEPAAI
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgaatgctgctgtccgtgctgtggtgcgcatgggaatatacgtgggggccaagngttac
tttatctatgagggttaccaaggcatggttgatggcggcagtaacatcgtggaagccaac
tgggaaagcgtctccagcattctgcaagtgggaggcaccatcataggcagcgctcgctgc
aaggccttccgcacccgggagggtcggctgaaagccgccgggaacctggttcagcggggc
atcaccaacctgtgtgtgatcggcggggacggaagtctcaccggggccaacatcttccgg
aaggagtggagcgggctgctcaaagagctggccgaaaatggtacgtctgtgcgcccgcct
gtcccccgggggattttctgttccctccgttcatttgccgttcccctcggagcgctccga
actcacgcgtccgcccagctgacggtcgcgtggcgcttggaggtgagggtgcgggtgtcc
accaccccgtgcgtccggctctgccgggggccccccggtgtctgcctcgttgcgagactt
gaggtgacttgtagcagaggaccttctgtgttccacggcccgtaccttggaagggtgctg
atgcggaggatcgagatgggcattctgggctgcggtgtagacctcagtcccgaccccggg
aggtcccctggtggcgtctgggctgcggtggtggacctcagtcccaccctggtgggcggt
ctggctgcggtgtgggcctcagtcccgacccctggagtcccctggtgggcggtctgggct
gcggtgtgggcctcagtcccgaccctggaggtccccgacctcagcctgaccccgggaggt
cccctggtgggcgtctgggctgcgtgtgggcctcagtcccgaccccaggaggtccactgg
tgggcgttctgggctggcggtgtggacctcagtccaaccctggtgggcgttcttgggctg
cgatgggcgttctggctgcggtgtggaccgcagtccccgaccccgggaggtcccctggtg
ggcgtctggctgcgtgtggacctcagtcccaaccctggtgggcgtctgggctgcggtgtg
ggcctcagtccgaccccgggaggtcccctggtgggctttctgggctgcagtgtgggcctc
agtcccgaccccaggaggtccactggtgggcgttctggctgcggtgtggacctcagtcca
accctggtgggcgttcttgggctgcgaatctcccccggaagaaggctgcaggagaacatg
tgcgtcaagctctcggagtacgcgcgtcctggtttcccggcctcgcggcgctccgtcacc
cgctctagccgtgacgggtgcagccgtgggatttccgcgggggacggacttggagggaca
ccgtgggagtgtgggctcttgaagcgagggggctgcggggacaacaggtgtgggctcagt
gccaggctggaccgggtcctgcacgagaaccgcgcccggaagaaaagactgaatatcatc
attgtggcggaaggtgccatcgacacccaaaataaacccattacctctgagcaaatcaag
gagcttgtggtcacgcagctggggtacgacacgcgggtgaccatccttggacacgtgcag
agaggcgggactccttcggcctttgacaggattttggccagtcgcatgggggtggaggcc
gtggtcgcccttctccaggccaccccagagaccccggcctgcgtggtgtcgctgagcggg
aaccaggccgtccgcctgcccctggtggagtcgtgtgcaagatggtgaacccaggacgtg
cagaaggccatggacgagaggagatttaaggacgccgtgcgactccgcggaaggtgactc
tcccgaggcaatctgaacacctacaagcggctcgccatcaagatgccagatgaccagatc
cgcaagtgggtgccgccgcggagcaactgcaacgtggcagtcatcaacggggggcgaccc
ccagccgccgggatgaatgcggccgtgcgctcgngcgtgcgcgtgggcatctcgaagggc
acaagatgtttgaccatctacgacggcttcgagggccttcgccagggccaggtgataaag
gagatcggctgggcggatgtcggaggctggatggaccggcggagaggctacattcttggg
accaaacggacgctgcccgggaagtccctggaggcgatcgccgagcagatgcggacccac
agcatcaacgcgctgttgatcattggtggatttgaggtacgtgcgcctgacactgcctac
ctgggactgctggagctgtcagctgcccgggagaagtacgaggagctctgtgtccccatg
gtcatggtccccgccacggtgtccaacaacgtgccgggctccgatttcagcatcggtgcg
gacaccgccctgaacaccatcaccgacacgtgtgaccgcatcaagcagtcggccagcggg
accaagcgccgcgtgttcatcatcgagaccatggggggctactgcggctacctggccaac
atgggggggctcgccgccggagccgacgccgcctacatcttcgaagagcccttcgacatc
cgcgatctgcaggccaacgtggagcacctgaccgagaaaatgaagaccaccatccagagg
ggactcgtgctcaggaacgagagctgcagcgagcactacaccacggacttcatctaccat
ctctactccgaggagggcaagggcgtgttcgactgcaggaagaacgtgctgggccacatg
cagcagggtggagcgccttcaccgtttgacagaaactttggaaccaagatctccgccaga
gccatgcagtggatcagcacaaagctaaaggaggctcaggggaaaggaaaaaggtttgtg
accgatgattgcatttgcgtgctgggaataagcaaaagaaacctccttttccaacctgtg
gcacaactgaagaaggaaacagactttgagcaccggatccccaaggagcagtggtggctg
aagctgcggccgctcatgaagatcctggccaagtacaaggccagctacgaggtgtccgac
cccggccagctggagcacgtgcaccaccgaggccacgaggagcccgccgccatctag

KEGG   Felis catus (domestic cat): 111561278
Entry
111561278         CDS       T02385                                 
Symbol
PFKP
Name
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00030  Pentose phosphate pathway
fca00051  Fructose and mannose metabolism
fca00052  Galactose metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca03018  RNA degradation
fca04066  HIF-1 signaling pathway
fca04152  AMPK signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111561278 (PFKP)
   00030 Pentose phosphate pathway
    111561278 (PFKP)
   00051 Fructose and mannose metabolism
    111561278 (PFKP)
   00052 Galactose metabolism
    111561278 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111561278 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111561278 (PFKP)
   04152 AMPK signaling pathway
    111561278 (PFKP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111561278 (PFKP)
   04919 Thyroid hormone signaling pathway
    111561278 (PFKP)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    111561278 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    111561278 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    111561278 (PFKP)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111561278 (PFKP)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111561278 (PFKP)
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111561278 (PFKP)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 111561278
NCBI-ProteinID: XP_023112050
LinkDB
Position
B4:2990798..3043961
AA seq 587 aa
MDDDDVSARKGSFRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAAGNLVQRGIT
NLCVIGGDGSLTGANIFRKEWSGLLKDWQKRVRLASDTAREHAYLNLVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLVEC
VQMTQDVQKAMDERRFKDAVRLRGRSFESNLNTYKRLAIKMPDDQIPKSNCNVAVINVGA
PAAGMNAAVRSAVRVGISEGHKMFAIYDGFEGFAKGQIKEIGWADVGGWTGQGGSILGTK
RTLPGKSLEAIAEQMRTHSINALLIIGGFEAYLGLLELSAAREKYEELCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDPHPCVRCPLAGAPRWAVTQAALLLLL
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgacgacgacgtctccgcccgcaagggctccttccgaaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgcccaaggtatgaat
gctgctgtccgtgctgtggtgcgcatgggaatatacgtgggggccaaggtgtactttatc
tatgagggttaccaaggcatggttgatggcggcagtaacatcgtggaagccaactgggaa
agcgtctccagcattctgcaagtgggaggcaccatcataggcagcgctcgctgcaaggcc
ttccgcacccgggagggtcggctgaaagccgccgggaacctggttcagcggggcatcacc
aacctgtgtgtgatcggcggggacggaagtctcaccggggccaacatcttccggaaggag
tggagcgggctgctcaaagactggcagaaaagggtacgcttggcatccgacacggcccgc
gagcacgcctacctcaacctcgtgggcatggttggctccatcgacaacgacttctgcggc
actgacatgaccatcggcaccgactccgccttgcacaggattatcgaggtcgtggacgcc
atcatgaccaccgcccagagccaccagaggacctttgtgcttgaggtcatggggagacac
tgcgggtacctagccctggtgagcgccctggcctgcggggcagactgggtgttccttcca
gaatctcccccggaagaaggctggcaggagaacatgtgcgtcaagctctcggagaaccgc
gcccggaagaaaagactgaatatcatcattgtggcggaaggtgccatcgacacccaaaat
aaacccattacctctgagcaaatcaaggagcttgtggtcacgcagctggggtacgacacg
cgggtgaccatccttggacacgtgcagagaggcgggactccttcggcctttgacaggatt
ttggccagtcgcatgggggtggaggccgtggtcgcccttctccaggccaccccagagacc
ccggcctgcgtggtgtcgctgagcgggaaccaggccgtccgcctgcccctggtggagtgt
gtgcagatgacccaggacgtgcagaaggccatggacgagaggagatttaaggacgccgtg
cgactccgcggaaggagcttcgagagcaatctgaacacctacaagcggctcgccatcaag
atgccggatgaccagatcccaaagagcaactgcaacgtggcagtcatcaacgtgggcgcc
cccgccgccgggatgaatgcggccgtgcgctcggccgtgcgcgtgggcatctccgaaggg
cacaagatgtttgccatctacgacggcttcgagggcttcgccaagggccagataaaggag
atcggctgggcggatgtcggaggctggaccggccaaggaggctccattcttgggaccaaa
cggacgctgcccgggaagtccctggaggcgatcgccgagcagatgcggacccacagcatc
aacgcgctgttgatcattggtggatttgaggcctacctgggactgctggagctgtcagct
gcccgggagaagtacgaggagctctgtgtccccatggtcatggtccccgccacggtgtcc
aacaacgtgccgggctccgatttcagcatcggtgcggacaccgccctgaacaccatcacc
gacccccacccgtgtgtccggtgtcccctcgctggagcgccccgctgggccgtgacccaa
gccgccctgcttttgctgctgtga

DBGET integrated database retrieval system