KEGG   Felis catus (domestic cat): 101088885
Entry
101088885         CDS       T02385                                 
Symbol
MALT1
Name
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1 isoform X1
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101088885 (MALT1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101088885 (MALT1)
   04660 T cell receptor signaling pathway
    101088885 (MALT1)
   04662 B cell receptor signaling pathway
    101088885 (MALT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088885 (MALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101088885 (MALT1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     101088885 (MALT1)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C14: caspase family
   101088885 (MALT1)
SSDB
Motif
Pfam: MALT1_Ig Ig_3 Ig_2 Peptidase_C14 ig I-set V-set Ig_5 Ig_4 Ig_6
Other DBs
NCBI-GeneID: 101088885
NCBI-ProteinID: XP_003995307
Ensembl: ENSFCAG00000013987
UniProt: M3WJV4
LinkDB
Position
D3:79464324..79528875
AA seq 848 aa
MRPAGAAAVAGSSARDASLCGELLQAPPPPASQPPPAAPSGPPLPAPSATLNRLPEPLLR
RLSGSLDRAPEGRGWRRLAEVAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEK
GCTVTELSDFLQAMEHTEVLGLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQ
WFKMNKEIPNGNASELIFNTVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDVTEVTGNLQ
GSLDGISESKLQICVEPRSQKLMPGSTLLLQCVAVGSPIPHYQWFKNESPLIHETKKLYM
VPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDAVECTEDELNNLGCPDHEEQTGDQ
PLAKDKVALLIGNMNYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDE
FLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLN
VFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKD
RLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTAYSAESLVRN
LQWAKAHELPESMCLKFQCGVQIQLGFAAEFSNVMIIYTSIVHKPPDVVMCDAYVTDFPL
DLDIDPKAANKGTPEETGSYLVSKDLPKQCLYTRLSSLQKLKEHLIFTVCVSYQYSGLED
TVEEKQEVNVGKPLIAKLDIHRGLGRKTCFQTCVMCNGPYPSPASTSPGAGQYHSSQDSF
HALYHSHLGNSSSVLPSDSCHCSRTADAFISSPHSHRDSCRFGRSNVPVETTDEMPFSLS
DGLRISDK
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgcggccggcgggagccgcggccgtcgcggggtcgtcggcgcgggacgcgtcgctgtgc
ggggagctgctgcaggccccgccgcccccggcctcgcagccgcctccggccgcgccctcg
ggcccgccgctccccgctccgagcgcgaccctcaaccgtcttccggagccgctgctgcgg
aggctcagcgggagcctggaccgagcgcccgagggccggggctggaggaggctggccgag
gtggcggggagtcgggggcgcctccggctcagctgtctggacttggagcagtgttctctt
aaggtcttggagcctgaaggaagcccaagcctatgtttactgaagctaatgggtgagaaa
ggttgtacggtcacagaactgagtgacttcctgcaggctatggagcacaccgaagttctt
gggcttctcagccccccaggaataaagatcaccgtaaacccagaatcaaaggcagtcttg
gctgggcagtttgtgaaactgtgttgccgggcaactggacatccctttgtacaatatcag
tggttcaaaatgaataaagagattccaaacggaaatgcatcagaactaatttttaacacc
gtgcacgtaaaagatgcaggcttttacgtctgtcgagttaataacaatttcacctttgaa
ttcagccagtggtcacagctggatgtttgtgatgtcacagaagtaacaggaaacctccag
gggagtttggatggcatctctgaatccaagttgcaaatctgcgttgaaccaaggtcccaa
aagctgatgcctggcagcacattgcttttacagtgtgtggctgttggaagccctattcct
cactaccagtggttcaaaaatgagtcaccattaatacatgagacaaaaaagctatacatg
gtgccttatgtggatctggaacaccaagggacctactggtgtcacgtatataacgatcga
gacagtcaagatagcaagaaggtagaaatcatcataggaagaacagatgcagtggagtgc
actgaagatgaattaaataatctcggatgccctgaccatgaagagcaaacgggcgatcag
cctttggcaaaggacaaggttgctcttttgataggaaatatgaattactgggaacacccc
aagctcaaagctcctttggtggatgtgtacgagttgaccaacttgttaagacaactagat
ttcaaagttgtttcgctgttggatctcacggagtatgagatgcgaaatgccgtggatgaa
tttttactccttttagacaaaggagtttatggactattatattatgcaggacatggttac
gaaaactttgggaacagctttatggtccctgttgatgctccaaatccatataggtctgaa
aactgcctctgtgtacaaaatatactgaaactgatgcaagaaaaggaaactggactcaac
gtgttcttgttggacatgtgtaggaaaagaaatgactatgatgacaccatcccgatcttg
gatgcactaaaagtcaccgccaacattgtgtttggatacgccacgtgtcaaggggcagaa
gcttttgaaatccagcattctgggttggcaaatggaattttcatgaaatttttaaaggat
agattattagaagacaagaaaattactgtgttactggatgaagttgcagaagacatgggt
aagtgtcaccttaccaaaggcaaacaggctctggagattcggagcagcttgtctgaaaag
agagcacttactgacccgatacagggaacagcatattctgcagaatctctggtgcggaat
ctgcagtgggccaaggcacacgaactcccagaaagtatgtgccttaaatttcagtgcggc
gtccagattcagttagggtttgccgcagagttctccaacgtcatgataatctacacaagc
atagtccacaagccgcccgacgtagtaatgtgcgatgcctatgtcacagattttcctctc
gacttagacattgatccaaaagctgcaaacaaagggacacctgaggaaactggcagctat
ttggtatcaaaggatctccccaagcagtgcctctatactcggctcagttcactgcaaaaa
ttaaaggaacatctgatcttcacagtgtgtgtgtcgtatcagtactcaggactggaagat
actgtagaggagaagcaggaagtgaacgttgggaaacccctcattgctaaactggacatt
caccggggtttgggaaggaagacttgcttccagacgtgtgtcatgtgtaacggcccttac
ccgagccccgcctccacctcgccgggggctggacagtatcactcgtctcaagactccttc
cacgccctttaccattcgcatcttggtaactcaagcagcgttttgccatcagacagttgt
cattgcagccggaccgcggatgcatttatctcaagtccccattcccaccgcgactcgtgt
cgctttgggagaagtaacgtgccagtagagacaacggatgagatgccgttcagtctctct
gacgggctccgaatttcagacaagtga

DBGET integrated database retrieval system