KEGG   Felis catus (domestic cat): 101089087
Entry
101089087         CDS       T02385                                 
Symbol
MFN1
Name
(RefSeq) mitofusin-1
  KO
K21356  mitofusin 1 [EC:3.6.5.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04621  NOD-like receptor signaling pathway
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101089087 (MFN1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101089087 (MFN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101089087 (MFN1)
   05022 Pathways of neurodegeneration - multiple diseases
    101089087 (MFN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101089087 (MFN1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-
     101089087 (MFN1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101089087 (MFN1)
SSDB
Motif
Pfam: Fzo_mitofusin Dynamin_N MMR_HSR1 Paralemmin
Other DBs
NCBI-GeneID: 101089087
NCBI-ProteinID: XP_004001214
Ensembl: ENSFCAG00000028181
UniProt: A0A2I2U8C5
LinkDB
Position
C2:complement(89755844..89793278)
AA seq 742 aa
MAETASPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDQIATEDDLIEIQGY
KNKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG
DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP
GTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKQFFHKVNERLSKPNIFILNNRWD
ASASEPEYMEDVRRQHMERCLHFLVEELKVVDPLEAQNRIFFVSAKEVLTARKHKAQGMP
EGGGALAEGFQARLQEFQNFEQIFEECISQSAVRTKFEQHTIRAKQILDTVKIIMDSVNV
AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIREVTEEVANKVSCAMTDEICRL
SVLVDEFCSEFHPTPSVLKVYKNELNKHIEDGMGRNLADRCTSEVNASMLQSQQEIIENL
KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGPTN
AQRVLLGLSEPIFQLPRSLASTPTAPTNPATPDNASQEELMVTLITGLASLTSRTSMGII
VVGGVIWKTVGWKLISVSLSMYGALYLYERLTWTTRAKEKAFKQQFVNYATEKLQMIVSF
TSANCSHQVQQEMATTFARLCQQVDITQRHLEEEIARLSKEIDQLEKIQSNSKFLRNKAV
QLENELENFTKQFLHSSNEEES
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggcggaaactgcttctccactgaagcactttgtgctggctaagaaggcaattactgca
atctttgaccaattactggagtttgttactgaaggatcccattttgttgaagcaacatac
aagaatccagaacttgatcaaatagctactgaggatgatctgatagaaatacagggttat
aaaaacaagctttccatcattggtgaggtgctgtctcggaggcatatgaaagtggcattt
tttggcaggacgagcagtgggaagagctctgttatcaatgcaatgttgtgggataaagtc
ctccctagtgggattggccatacaaccaattgcttcctgagtgttgaaggaactgatgga
gataaagcctatcttatgacagaaggatcagatgaaaaaaagagcgtgaagacagttaat
cagctggcccatgcccttcatatggataaagacttgaaagctggctgtcttgtgcatgta
ttttggccaaaggcaaaatgtgccctcttgagagatgacctggttttagtggacagtccg
ggtacagatgtcactacagagctggatagctggattgataaattttgcttagatgctgat
gtcttcgttttggttgcaaactctgaatcaacactaatgaacacggaaaagcagtttttt
cacaaggtaaatgagcgactttccaaacctaacattttcattttgaataatcgttgggat
gcctctgcatcagagccagaatatatggaagatgtacgtagacagcacatggaaagatgc
ctgcatttcttggtggaggagcttaaagttgtggatcctttggaggcacagaatcgtatc
ttctttgtttctgcaaaggaagttcttactgctagaaagcacaaagcacaggggatgcca
gaaggtggtggggcacttgctgaaggattccaggcaagattacaggagtttcagaatttt
gaacaaatttttgaggagtgtatctcgcagtcagcagtgagaacaaagtttgaacagcac
actatcagagctaaacagatactagatactgtgaaaatcataatggattcagtaaacgtg
gcagcagcagagaaaagggtttattcaatggaagagagggaagatcaaattgatagactg
gactttatccgaaaccagatgaaccttttaacactggatgttaagaaaaaaatcagggag
gttacagaggaggtggcaaacaaggtgtcatgtgcaatgacagatgaaatttgccgactg
tctgtgttggttgatgaattttgttcagagtttcatcctactccaagtgtattgaaagta
tataaaaatgagttaaataagcacatagaagatggcatgggaagaaatttagccgatcgg
tgcacaagcgaagtcaatgcttcaatgcttcaatcccagcaagaaattattgaaaatttg
aagccattacttccagctggtatacaaaataaactacatacactgattccttgcaagaaa
tttgatctcagctatgacctaaattgccataagttatgttcagattttcaagaggatatt
gtatttcgtttttccctgggctggtcttcccttgtccatcgtttcctgggcccaacgaat
gctcagagggtgctgctaggattatcagagcccatcttccagctccccagatctttagcc
tctactcccactgctcctactaatccagcaacgccagacaatgcatcacaggaagaactc
atggttaccttaataacgggattagcttctctcacatctagaacttctatgggcatcatc
gttgttggaggggtgatttggaaaactgtaggctggaaactcatatctgtttcattgagt
atgtatggagctttgtatctttatgaaaggctgacctggaccacgcgtgctaaggagaaa
gcctttaaacagcagtttgtgaactatgcaactgaaaaactgcagatgattgtcagcttc
acgagtgcaaactgtagccatcaagtacaacaggaaatggcaaccacttttgctcgcctg
tgccaacaagttgatattacacaaagacatctggaagaagaaattgctagattatccaaa
gaaatagatcaactggagaaaatacaaagcaattcaaagttcttaagaaataaagccgtt
caacttgaaaatgagctggagaattttactaagcagtttctacattcaagcaatgaagaa
gaatcttaa

KEGG   Felis catus (domestic cat): 101101068
Entry
101101068         CDS       T02385                                 
Symbol
MFN2
Name
(RefSeq) mitofusin-2 isoform X2
  KO
K06030  mitofusin 2 [EC:3.6.5.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04621  NOD-like receptor signaling pathway
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101101068 (MFN2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101101068 (MFN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101101068 (MFN2)
   05022 Pathways of neurodegeneration - multiple diseases
    101101068 (MFN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101068 (MFN2)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101101068 (MFN2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-
     101101068 (MFN2)
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    101101068 (MFN2)
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    101101068 (MFN2)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101101068 (MFN2)
SSDB
Motif
Pfam: Fzo_mitofusin Dynamin_N MMR_HSR1 Streptin-Immun Synaptobrevin
Other DBs
NCBI-GeneID: 101101068
NCBI-ProteinID: XP_003989549
Ensembl: ENSFCAG00000000076
UniProt: M3VU19
LinkDB
Position
C1:8780536..8809453
AA seq 757 aa
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDT
YRNAELDPVTTEEQVVDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK
VLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSVKTVNQLAHALHQDEQLHAGSLVS
VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF
FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRGQAGDR
IFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ
HTVRAKQIAEAVRLIMDSLHVAAQEQRVYCLEMREERQERLRFIDKQLELLAQDYKLRIK
QITEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD
RCSTAITSSLQTMQQDMIDGLKPLLPASVRSQIDMLVPRQCFSLSYDLNCDKLCADFQED
IEFHFSLGWTMLVNRFLGPKNSRRALMGYGDQVQRPIPLTPANPSMPPLPQGSLTQEELM
VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTRAKERA
FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQDIAAMNKK
IEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtccctgcttttctctcggtgcaactccattgttacagtcaagaaggacaagagacac
atggctgaggtgaatgcttccccactcaagcactttgtcactgccaagaagaagatcaat
ggcatttttgagcaactgggggcctacatccaagagagcgccaccttccttgaagacacc
tacaggaatgcggaactggaccccgttacgacagaagaacaggtcgtggacgtcaaaggc
tacctgtccaaagtgaggggcatcagtgaggtgttggcccggcggcacatgaaagtggct
tttttcggccggacgagcaacgggaagagcaccgtgatcaatgccatgctctgggacaaa
gttctgccctcagggatcggccacaccaccaactgcttcctgcgggtagagggcacagat
ggtcacgaggccttcctcctcacagagggctcggaggagaagaggagcgtcaagactgtg
aaccagctggcccatgcccttcaccaggacgagcagctccatgctggcagcctagtgagt
gtgatgtggcccaactccaagtgcccacttctgaaggatgacctcgtgctgatggacagc
cctggcatcgacgtcaccacagagctggacagctggattgacaagttttgcttggacgcc
gacgtgtttgtgttggtggccaactcagagtccaccctgatgcagacggagaagcagttc
ttccacaaggtgagtgagcgcctgtcccgcccgaacatcttcatcctgaacaaccgctgg
gacgcgtccgcctcggagcctgagtatatggaagaggtgcggcggcagcacatggaacgt
tgtaccagcttcctggtggatgagctgggcgtggtggaccgaggccaggctggagaccgc
atcttctttgtatctgccaaggaggtgctcaacgccaggatccagaaggcccagggcatg
cctgaaggagggggtgctcttgcagaaggctttcaagtgaggatgtttgagtttcagaac
tttgaaaggagatttgaggagtgcatctcccagtctgcggtgaagaccaagttcgagcag
cacacggtccgggccaagcagattgcggaagcggtgcgtctcatcatggactccctgcac
gttgcggcacaggagcagcgggtctactgcctggagatgcgggaagaacggcaagagcgg
ctgaggtttattgacaagcagctggagctcctggcgcaggactataagctgcggattaaa
cagatcacggaggaggtggagaggcaggtgtccactgcgatggcggaggagatcaggcgc
ctctccgtgctggtggacgaataccagatggatttccacccttccccagtggtcctcaag
gtctacaagaacgaattgcaccgccatatagaggaaggactgggccggaatatgtccgac
cgctgctccacagccatcaccagctctctgcaaaccatgcagcaggacatgatagatggt
ttgaaacccctccttcctgcgtctgtgcggagtcagatagacatgctggtccctcggcag
tgcttctccctcagctacgacctgaactgtgacaagctgtgtgctgacttccaggaggac
atcgagttccatttttcactcgggtggaccatgctggtgaataggttcctgggccccaag
aacagccgccgggccttgatgggctacggtgaccaggtgcagcgccccatccccctgacg
ccagccaaccccagcatgcccccgctgccgcagggctccctcacccaggaagagctcatg
gtttccatggtcaccggcctggcctccctgacgtccaggacctccatgggcattctcgtt
gtcggaggcgtggtgtggaaggcggtgggctggcggctcattgccctgtcctttgggctc
tatggcctcctgtatgtctacgagcgtctgacctggaccaccagggccaaggagagggcc
ttcaagcgtcagttcgtggagtatgccagcgagaagttgcaactcatcatcagctacact
ggctccaactgcagccaccaagtccagcaggaactgtctgggacctttgcccacctgtgc
cagcaagttgacgtcacccgggagaacctggagcaggacatcgccgccatgaacaagaaa
atcgaggttctcgattcacttcagagcaaagcaaagctgctcaggaacaaagccggctgg
ttggacagcgagctcaacatgttcacgcaccagtacctgcagcccagcagatag

DBGET integrated database retrieval system