KEGG   Felis catus (domestic cat): 101089236
Entry
101089236         CDS       T02385                                 
Symbol
FCER1G
Name
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04611  Platelet activation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04664  Fc epsilon RI signaling pathway
fca05152  Tuberculosis
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101089236 (FCER1G)
   04071 Sphingolipid signaling pathway
    101089236 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101089236 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    101089236 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    101089236 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    101089236 (FCER1G)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101089236 (FCER1G)
  09163 Immune disease
   05310 Asthma
    101089236 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089236 (FCER1G)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101089236 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 101089236
NCBI-ProteinID: XP_003999613
UniProt: A0A2I2V145
LinkDB
Position
F1:complement(66012129..66016130)
AA seq 86 aa
MIPAVLLIVLLSVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEK
SDGIYTGLSTRNQETYETLKHEKPPQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgattccagctgtgctcttgatcgtcctcctttcagtggaacaagcagccgccctggga
gagcctcagctctgctatatcttggatgccatcctgttcttgtatggtatagtcctcacc
ctgctctactgccgcctcaagatccaggtgcggaaggcggcgatagccagctatgagaaa
tcagatggcatttacacgggcctgagcacccggaaccaggagacttatgagaccctgaag
catgagaaaccaccccagtaa

KEGG   Felis catus (domestic cat): 101094323
Entry
101094323         CDS       T02385                                 
Symbol
FCER1A
Name
(RefSeq) high affinity immunoglobulin epsilon receptor subunit alpha
  KO
K08089  high affinity immunoglobulin epsilon receptor subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101094323 (FCER1A)
   04071 Sphingolipid signaling pathway
    101094323 (FCER1A)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    101094323 (FCER1A)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101094323 (FCER1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set Ig_5 Receptor_2B4 Ig_6 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 101094323
NCBI-ProteinID: XP_006943111
Ensembl: ENSFCAG00000015276
UniProt: M3WMA5
LinkDB
Position
F1:complement(67518802..67524452)
AA seq 263 aa
MPVFLGGPALLWTALLLLLYPDGMSAGTREPTVSLNPPWTTILKEDSVTLTCKENNSLEL
NSTVWFHNKTKLGVTTLTLDIVKAQIRDSGEYTCQNKGSMLSKPVSLKVFREWLLLQAST
EVVLEGESFLIRCHSWRNLNVKKVTYYRNGKFLQFWYDNYNITINNATETDSGTYYCTGW
ISKQNHISNFLNIVVRKDSPPEHQSKYYWLQFVIPSLVVLLFAADTGLFISTQQQLTLLL
KIKTTRRSRNLMDPRPKPDPKKN
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccggttttcctgggaggccctgctctgctgtggacagcactgctgctcctcctctat
ccagatggcatgtcagcaggcacccgggaacctacagtgtccttgaatccaccgtggact
accatattgaaagaagacagtgtgactcttacatgtaaagagaacaattctcttgaactc
aactctactgtgtggttccacaacaagaccaagttgggagtgacaactttaactttggac
atcgtgaaagcccaaatccgcgatagtggggaatacacgtgtcagaacaaaggatccatg
ctgagtaaacctgtgtccttaaaagtcttccgtgagtggctgctccttcaggcctctact
gaggtggtgctggagggtgagtccttcctcatcaggtgccacagttggaggaatttgaat
gtcaaaaaagtgacctactacaggaatggcaagttcctccagttctggtacgacaactac
aacatcaccattaacaatgccacagaaacagacagcggcacctactactgcacgggctgg
atttcaaagcaaaatcacatctctaacttcctcaacatcgttgtgagaaaagattcccct
ccggagcaccaaagcaaatactactggctacaatttgtgatcccatcgttggtggtgctt
ctgtttgctgcggacacggggctgtttatctcgacccagcagcagctgaccctgctcttg
aagattaagacgaccaggaggagcaggaaccttatggacccacgtcccaagccagacccc
aaaaagaactga

KEGG   Felis catus (domestic cat): 101101505
Entry
101101505         CDS       T02385                                 
Name
(RefSeq) high affinity immunoglobulin epsilon receptor subunit beta
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101101505
   04071 Sphingolipid signaling pathway
    101101505
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    101101505
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101101505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101101505
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   101101505
SSDB
Motif
Pfam: CD20 DUF6114
Other DBs
NCBI-GeneID: 101101505
NCBI-ProteinID: XP_023095640
Ensembl: ENSFCAG00000012212
LinkDB
Position
D1:106469051..106476666
AA seq 243 aa
MDTESSSRADLAFPMSQSPSSVPQIELSEVSLHDNALREEAASAPPSRTWLRFLRRELEF
LGVTQILIALICLCFGIIVCSAINASEFKEDFFSSFKAGYPFWGAMFFAISGFFPILSEK
KYAIYLVWGSLGANTVSSIVAGIGIFILTVNLKTCWPHIYNCPEAHENDFCFVAWFSTEI
VAMILFLTVLGFCSAVSLMIYGLGEVFQEKKIPEDRLYEELNVYSPIYSELEDKGETSSP
ADS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggacacagaaagtagtagcagggcagatcttgctttcccaatgtcacaaagcccctcc
agcgtgccccagatcgaactttcggaagtatctctccatgataacgccttacgggaggag
gctgcctcagccccaccaagccgtacctggctgaggtttttgaggagggagctggaattc
ctgggggtaacacaaattctgattgctttgatatgtctttgttttggaataatcgtctgc
tctgcgatcaatgcttccgaatttaaggaagattttttttcatcatttaaagcaggctac
ccattctggggagcaatgttttttgctatttccggattctttccaattctgtctgaaaag
aaatatgccatatatctggtgtggggaagcctgggagcaaacaccgtcagcagcattgtt
gcaggaataggaatcttcatcctgaccgtcaacttgaagacttgctggcctcatatctac
aactgcccggaagctcatgaaaatgacttctgctttgtggcttggttttccaccgagatc
gtggcaatgatcctgtttctcaccgtcctggggttttgtagtgctgtgtcactcatgatc
tatggccttggagaagtattccaggaaaagaagattccagaagatcgtctttatgaagaa
ttaaacgtatattcgccaatttacagtgagttggaagacaaaggggagacatcttctcct
gctgattcataa

KEGG   Felis catus (domestic cat): 102902042
Entry
102902042         CDS       T02385                                 
Name
(RefSeq) membrane-spanning 4-domains subfamily A member 3-like
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102902042
   04071 Sphingolipid signaling pathway
    102902042
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    102902042
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102902042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    102902042
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   102902042
SSDB
Motif
Pfam: CD20 DUF6097 DUF4271
Other DBs
NCBI-GeneID: 102902042
NCBI-ProteinID: XP_019668017
Ensembl: ENSFCAG00000029925
UniProt: A0A5F5XPA5
LinkDB
Position
D1:complement(106497316..106510761)
AA seq 243 aa
MSKTPDSDGKTVDIPPNPNQSTSLGKTEKPGTLKHLLDKLQKFLKGNLKALGVAQIMIGV
KCIFYGIIGFFAFDSEMYPTVFFSIYTGFPLWGALSFIVSGSLTVVSAKKQTKSLLRKNI
GANTLSTLVSIVGICILSYNLTKNFRYDCKKETLCLGIKSIAIGLVIVLMILTCLQILIS
LPLSMLVYNVDDRNIHWISVSFCWKSPSESPYQDLLPQTSIYQELECKEETPSCYPTDTS
KQI
NT seq 732 nt   +upstreamnt  +downstreamnt
atgagcaaaactccggattctgatgggaagactgtggacattcctccaaacccaaaccaa
agtacctcattaggaaagactgaaaagcctggtaccctgaaacatttactcgacaagctg
cagaaattcctgaaggggaatctaaaagctctgggggtggctcagattatgattggtgtg
aaatgcatcttttatgggataattggattttttgcttttgattctgaaatgtacccaact
gttttcttctcaatttacacaggcttccctttatggggggcattgtcttttatcgtgtct
ggatctctgactgttgtgtctgccaagaagcaaacaaaatcactgctgaggaagaatata
ggtgctaacactcttagcacattggtctcgattgttgggatctgtattctgtcatataat
ttaacaaaaaatttccgctatgattgcaagaaggaaactctctgcttgggcatcaaatca
attgcaattggacttgtgattgtcctgatgatcctaacttgtctgcaaattttaatttca
ctccctctctccatgctcgtctataatgtggatgacaggaatattcactggatttctgta
tctttttgctggaaatcaccttctgaaagtccttatcaagacttgttgcctcaaacttca
atctatcaagagcttgaatgtaaagaagaaacaccttcatgttatcccacagatactagt
aaacaaatatga

KEGG   Felis catus (domestic cat): 102902189
Entry
102902189         CDS       T02385                                 
Name
(RefSeq) membrane-spanning 4-domains subfamily A member 3-like
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102902189
   04071 Sphingolipid signaling pathway
    102902189
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    102902189
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102902189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    102902189
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   102902189
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 102902189
NCBI-ProteinID: XP_023095644
LinkDB
Position
D1:complement(106530474..106547457)
AA seq 236 aa
MREIVASSGIAVYVSSNQNHGVRLAKAVTPDPSGHTPNKLQRFLKEHLKLLGVAQIMISV
KFIVYGIIGISVLHYATPNTGFFSFQIGFPIWAALPFIVSGSMTVLSAKKQTKALLRGNL
RANTLSTVVSSIGILILSHNLVKTTFMDCDVEDLCLGVTSVVTGLVVILMILNCLQFLIT
LALSMLTYNVDGKRIDWVSALSFLKSASESPYQGLVHQPSFYQNLERKDTLLYYNT
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagagaaattgtggcttccagtgggatagctgtgtatgtttcctcaaatcaaaaccac
ggtgtccggttagcgaaggctgtaacacctgacccctcaggacacacaccaaacaagctg
cagagattcctgaaggaacatctcaaactcctgggggtggctcagattatgattagtgtg
aaattcatcgtctatgggataattggaatttcagttctccattacgcaacacccaacacc
ggtttcttctcatttcagataggcttcccgatatgggcagctttaccttttatcgtttct
ggatctatgacagttctgtctgcaaagaagcaaaccaaagctctgctgagaggaaatctg
agagctaacactctcagcacagttgtttcgagtatcggaattctcattctttcacacaac
ttagtaaaaaccaccttcatggactgtgacgtggaagatttatgtcttggtgtcacatca
gttgtaactggtcttgtggttatactgatgatcctgaactgtctgcaatttttaattaca
cttgctctgtccatgctcacctacaatgtggatggcaagagaattgactgggtttctgca
ttatctttcctgaaatcggcttccgaaagtccttatcaaggcttggtgcatcagccttcc
ttctaccaaaaccttgagaggaaggacacattgttatactataacacctga

KEGG   Felis catus (domestic cat): 102902259
Entry
102902259         CDS       T02385                                 
Name
(RefSeq) high affinity immunoglobulin epsilon receptor subunit beta isoform X2
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102902259
   04071 Sphingolipid signaling pathway
    102902259
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    102902259
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102902259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    102902259
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   102902259
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 102902259
NCBI-ProteinID: XP_011285226
UniProt: A0A5F5XZ56
LinkDB
Position
D1:complement(106584927..106608981)
AA seq 238 aa
MSDVVATEGTAEGISTNEIQSAQVERADAPDLAQRLHSKLRDFLKKNLQSLGVAQIMIGL
KCFFFGITEIFLYWHSDLRNLLFCFYIGYPFWAAASFIMSGSLTISCARKQTKFLIEVSI
GANIISTLLSSSGIILLSVNLVDIVLLECWELPACSLVKSFITNIVILQMILTCVQIFIS
FSLCGLTYTVDGKEISWASALSCLIRSHSEDPYQDLLTQPETYEDLVLQDIDQVHSHP
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtgatgtcgttgctactgaggggactgctgagggcatttcaacaaatgaaattcaa
agtgcgcaggtcgaacgagcagacgcacccgatttagctcaacgtctacacagcaagctg
cgtgatttccttaaaaagaatctgcaatccctgggtgtagctcagataatgattggcctg
aaatgtttcttttttgggatcactgagatttttctttactggcactctgacttaaggaat
cttttattctgcttttatattggttacccgttctgggctgcagcatctttcatcatgtct
ggatctttgaccatctcatgtgcaagaaaacaaacaaaatttctgatcgaagtcagtatt
ggagctaacattatcagcacactactttcaagcagtgggataattcttctctccgtgaat
ttagttgacatagtcttacttgaatgctgggagttaccggcgtgttcgttggttaaatcg
ttcataactaatattgtgatccttcaaatgatactgacttgtgtgcagatttttatttcg
ttctcactctgtgggctcacttataccgtggatggcaaggagatcagctgggcttctgca
ctaagttgcttgatcagatcacattctgaagatccttatcaagacttactgactcaacct
gaaacttacgaagatttagtgcttcaagacatagaccaggttcactctcatccatga

DBGET integrated database retrieval system